CAZyme Information: MGYG000001542_04508

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_04508
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	MGYG000001542_44|CGC6	27008.2	4.3069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 217838; End: 218587 Strand: -

Full Sequence      

MQIDPRTMEQLISLQMKNSIDLQGNKAADASSDMDGSLFDILLQEMMMADGSITTDDYED
QISNIEAQLNNYLNRINGQVSDSPDSYNIGSITANIPMSSGQPISSSKREIAADIQQLIA
DAAQRYGVAPSLIQAVIETESSFNPKVVSSAGAKGLMQLMDGTARGLGVTDSFDPAQNID
GGTRYLANLIRRFGGNESTALAAYNAGPGRVQRAGISNDQELMDKLHLLPRETQNYVFKV
MNARSKYEV

Enzyme Prediction     

No EC number prediction in MGYG000001542_04508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	124	244	4.7e-33	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.19e-47	130	243	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.22e-44	116	246	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.58e-42	118	248	9	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.83e-37	122	227	4	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.57e-34	121	214	3	102	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS14478.1	1.70e-157	1	247	1	247
AZK46857.1	2.45e-84	1	249	1	247
AWB45390.1	1.90e-68	1	249	1	246
AZN40496.1	2.17e-67	1	249	1	235
ANS75141.1	3.28e-66	1	247	1	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.27e-15	118	247	177	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	3.25e-15	118	247	177	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
5MPQ_A	4.75e-14	123	247	424	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.77e-14	123	247	428	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.79e-14	123	247	434	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.01e-32	69	243	18	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.07e-29	99	246	1406	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.07e-29	99	246	1406	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	9.77e-18	117	211	9	102	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
C5BCE9	8.90e-16	118	247	194	355	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_04508.