CAZyme Information: MGYG000001543_00050

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_00050
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765		88399.57	4.9299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 42653; End: 44950 Strand: -

Full Sequence      

MNYKKVAFILCSNCKEIMEETKCYINSLKIPTGMEKEIIIIEDGVSMTEGYNRAMRQSDA
KYKVYMHQDVFIVNAMIIENCIRIFTEHPEIGMLGVIGCKHLPEDGTWWEGRGCIGKTLE
DNLQIVKLLELGKVEGDFEFVQAIDGQIMITQYDVPWREDICKGWHFYDTSQCLEFARKG
YKTAVVNQDKPWVIHECGMDINIGYEAERIAFLEEYRQDLGKRDLLTEERIGILINGGRM
EEANTLLKEYKVINNIYNDTMAILEASIYLNVGEKEKAFECISKGIKYNHKNYELYFMLG
NYYLDKNKNQAFLCYENAEFYCNNEDRYFLTEVKNNLLSSDEVSVSPVSIVILSYNGKEM
TSICIDSIQQSMSPEAYELILVDNASEDGSQEWIQEYQRRWKQKIGMDNLKVIYNQENKG
FPAGCNQGIRVSETENDVFLLNNDTIVPPNAIFWLRMGLYENEKVGAVGSVSNHANNDQM
VKEKKSSIEEWFIYGTKHNIPMRYPYEKKAWLMGFAIMFKRKALEVVGYLDERFTPGNYE
DNDIGFRFLKAGYTQLLCKNSFIYHFGSVGFRKNQKSFDELLIRNRKKLEEKHGIPVEEY
CWVRTDLLELIDKDPDEQISILDVGCGLGATMAKAESIFPNSKVYGIEKNVEVAIIGKNL
TNIIQGDIEVVELPFIEKSFDYIIIGNVLEYLERPKETVLKLLPYLKEKGFMLISISKAI
KINEQITFITEKQIIEKIQNHSDLIIKAIEDKKADYILKVSVKST

Enzyme Prediction     

No EC number prediction in MGYG000001543_00050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	216	1.2e-76	0.9952380952380953
GT2	349	526	5.1e-18	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13712	Glyco_tranf_2_5	7.61e-90	7	216	1	210	Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
cd04186	GT_2_like_c	7.68e-37	350	567	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.68e-34	348	595	5	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	4.68e-19	350	475	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	6.68e-15	348	566	2	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95288.1	1.06e-139	234	716	9	479
CUU50244.1	1.04e-123	235	716	14	486
CBL07971.1	3.95e-120	229	754	3	522
AGF58245.1	5.26e-110	269	716	13	451
AQR96930.1	2.59e-105	269	716	13	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CC8_A	2.65e-11	590	716	11	130	Crystalstructure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 A resolution [Bacillus cereus ATCC 10987]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E0U4V7	8.56e-07	348	489	3	142	Poly(ribitol-phosphate) beta-glucosyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarQ PE=1 SV=1
Q9K623	9.44e-07	607	715	33	152	Malonyl-[acyl-carrier protein] O-methyltransferase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=bioC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_00050.