CAZyme Information: MGYG000001543_00156

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_00156
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738	MGYG000001543_4|CGC2	82881.43	4.8846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 176607; End: 178823 Strand: -

Full Sequence      

MMQNEGMYVDELLKEMTLKEKVSMIHGSGLFRTEGIERLGIPPLITSDGPMGVRNEFEDA
SWKTIGNSDDFVTYLPSNTALAATFNRELAYEAGKVLGCEARGRGKDVILAPGINIQRSP
LCGRNFEYMSEDPKLIEEIVVPFIQGIQENDVAACVKHFAANNQEIERLWVDTYMDERTL
REIYLPGFYAAISKGNSYTLMGAYNRLFGEHCSESKYLLTKVLREEWGYDGTVISDWGAV
HNTKNAAESSLDIEMSVTDNFNEYFMADPLIKAVENGEISEEHIDKKVKNILRLMYRLKM
IGSKKEERMSGTYNTPKHHEVVLNTAREAIVLLKNEEKRLPIKTTGLKKIAVIGHNAEKV
HANGGGSSEIKALYEISPLMGIKKLLGGNVKVEYAKGYYVPEKKDHSELNWQEASLLSHD
EAIINTAESVDQKMKERMEEIKRQQKLLREEAVALAKKVDEVIIVGGLNHDYDCEGWDRS
DLLLPYAQEELINAVLEVNANAVIVMITGAPVSYQAFVNKAKAILWTSYIGMEGGTALAE
VLFGQVNPSGKLPMTIPKSLNDSPAHVYGEYGTKESVTYKEGLLVGYRYFDTKEVEPEFC
FGHGLSYTTFECKDLLVSVDELTNENDLRVSLSMSVKNTGDIYGGETIQVYIKDMESSLI
RPVHELKEFKKVFLAPSKEETICFELHKEAFSFYDDTKSCFVVEPGKFIIEIASSSRDVS
LQGEITIENSYTYTLSKP

Enzyme Prediction     

No EC number prediction in MGYG000001543_00156.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	255	4.2e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.39e-102	3	719	32	757	beta-glucosidase BglX.
COG1472	BglX	2.12e-75	38	391	57	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.49e-72	12	672	56	728	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.04e-62	330	587	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.50e-48	38	294	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ83364.1	3.25e-303	1	731	1	730
QEH68829.1	7.55e-302	1	731	1	730
QNU68450.1	8.26e-302	9	733	6	715
ABX40607.1	3.69e-292	9	728	9	721
CBL11697.1	5.28e-286	8	727	5	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	6.01e-170	9	730	5	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.89e-128	13	728	9	664	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.02e-127	9	727	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.07e-125	9	727	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.57e-111	9	728	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	1.31e-175	9	728	46	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	3.29e-169	9	730	5	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.42e-125	13	728	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.95e-125	13	720	9	665	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	8.51e-122	9	719	2	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_00156.