CAZyme Information: MGYG000001543_00177

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_00177
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		43960.31	4.7789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 200727; End: 201854 Strand: -

Full Sequence      

MDMIVKYIDELLEKSTPERPMWNIEKLKSGAKSEWNYIDGCMIKAILEMYTITKEEKYLA
FADAFIDYRVNEDGTIAGYSVEKYNIDDVNAGKTLFELYDLTGKEKYRKAIDLVYSQVQT
QPRTKEGNFWHKKIYPNQIWLDGLYMGQPFYMEYETRFNNKKNYKDIFNQFFNVYELLRD
KETGLYYHAYDSSREMFWCDKETGLSKNFWLRAIGWYSMALLDTLDKCDPVGYEEEYEKL
KKIFLELMESMLKFQDESGMWYQVVNMGGREKNYLETSGSAIMAYALLKGVRLNFLPESY
REFGKKAMDGICDKYLNTEEGKMSLGGICLVAGLGGPDMRDGTYEYYMSEPIVQDDAKGV
GPFLLAYTELLRLKK

Enzyme Prediction     

No EC number prediction in MGYG000001543_00177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	372	2.3e-119	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.27e-100	23	373	22	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.82e-88	34	374	26	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX40590.1	7.03e-250	1	375	1	375
CBL09353.1	1.45e-219	1	374	1	374
VCV21981.1	1.45e-219	1	374	1	374
CBL12002.1	1.69e-218	1	374	1	374
AEN96572.1	5.98e-215	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.70e-112	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.32e-69	22	370	28	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.24e-68	22	370	18	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.94e-12	35	319	65	335	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.81e-10	35	311	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.91e-68	22	370	28	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.47e-41	146	375	1	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.47e-41	146	375	1	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	3.78e-22	35	375	29	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_00177.