CAZyme Information: MGYG000001543_00444

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_00444
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000001543_5|CGC1	38226.51	4.7292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 86971; End: 87981 Strand: +

Full Sequence      

MTNQTIVVSKDGDADFTTLQDAILSIDDNHVEQITILVKPGIYVEKVFIRKENIRIVGED
CHTTIFRYNDGAKTLRADGSEYGTFNTATILFAGNNIEVENITFENFAGIGRIAGQALAT
YIASDRTSFYHCRFLGYQDTIFTADSTALHMERLILPEWFKNSSVPIEHPNTRIYFEDCY
ICGDVDYIFGPSTAYFNHCEIFTRKLESENDSFITAASTPSNQEYGYVFNECYLTGDGRE
NSVYLGRPWRDYAKTAFIKCHMENHIKPIGWHNWNKVNAEVTTSYVEFNNVGLGASPSQR
ATFSKQLDNEGLLEYYSVKSVLADNDNWNPSRYNTL

Enzyme Prediction     

No EC number prediction in MGYG000001543_00444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	6	315	2.5e-89	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.02e-72	1	326	2	301	pectinesterase
COG4677	PemB	6.33e-64	6	325	83	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	6.07e-61	6	300	2	271	Pectinesterase.
PLN02682	PLN02682	9.01e-54	5	310	70	350	pectinesterase family protein
PLN02665	PLN02665	1.56e-51	4	311	68	344	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96886.1	2.38e-143	6	331	2	328
BAV13196.1	2.28e-101	6	330	1	320
ADL51177.1	2.28e-101	6	330	1	320
AGF58031.1	1.36e-93	6	328	2	319
AEI32806.1	1.93e-93	6	328	1	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.61e-40	6	303	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.02e-34	7	300	6	274	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.38e-28	2	331	2	340	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	2.07e-25	13	300	16	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.05e-24	13	300	16	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.12e-54	2	307	3	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O22149	6.08e-42	7	331	208	503	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2
Q9FM79	1.64e-41	6	324	82	375	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q7Y201	5.32e-40	8	315	304	589	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2
Q8VYZ3	6.88e-40	7	328	87	380	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_00444.