CAZyme Information: MGYG000001543_01514

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_01514
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964	MGYG000001543_6|CGC9	105724.96	4.562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 779971; End: 782865 Strand: -

Full Sequence      

MGSLKMKHRRLISLLTVFVMLAMLVFVNTNATAQSTNELENLSVQKEYRLIGYYASWAGY
ARNYGIDKVDFSNLTHLNFAFANLKSDGTVVVGDPWIDCQITSLYPSAGFTWEDQSNNTA
GHFGMLKKIKETYPNLKTLISIGGWTWSNNFSDVAADPVKREKMASSAVEFILKYGFDGI
DIDWEYPVEGGNNIPHRPTDKQNYVELVKLIRQKLDAQSAIDGKTYLLTIASSANQNYVN
NIDVTNMMKYLDWINLMTYDYHGGFDPQTNHNSPLYLNPKDTTGSIFSIEATVDAYINAG
ANPEDLNLGLPFYGRGWINVNATPETSLFHNGSAATSAGTDLGTWEGSSWDYWDIKTNYI
GKRGYVRYWDDYAKCPYLYSEQTKVFITYDDEESLGYKLDYLKSRNLGGGMFWECSGDKE
GELLEFTARSLGINNQVVTPTPIVTIAPTVSPSPTITPTPSVSLAPTPMVSPTPTPTINN
IEPWNNTKIYVAGDKVTYNGSIYEAKWWTLGNIPGTEEWGPWKNIGVVRNNTASTILGTS
FTPSEDANEILASENIQNETIPLWNSTTIYVAGDQAIYNGKVYEAKWWTLGDIPGTEDWK
PWKFIRNVGEVTPTPTLTPSATPTPIPTISPTPTISPTPTVMPTPTITPMISPTVSPTPT
PTIPSSDLPPYVLTGYWQNFNNGATSLKISDVPSTYNVICVAFAESTSTPGEVKFTLDSG
LSTALGGYTEAQFISDIAAAKAKGQKVIISIGGEVGTVSVANDTQADIFANSVYNLMTKY
GFDGVDIDLEHGISATYMEKALRSLYKKVGSDLIITMAPQTLDMQSTGYEYFKLALAIKD
ILTICNTQYYNSGAMLGYDGKVYSQGNADFLTALATIQLENGLRPDQVGLGLPASIKGAG
SGYIDPSIVTSAFKSLVTGSKAGNFVAPNTYPTLRGIMTWSINWDAQNNYKFSNAVAACF
DELN

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	47	421	4.6e-87	0.9493243243243243
GH18	671	952	1.2e-24	0.9594594594594594
CBM5	483	522	6.8e-16	0.925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	6.86e-144	51	418	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	2.19e-126	49	418	1	334	Glyco_18 domain.
COG3325	ChiA	1.48e-125	47	434	37	439	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	1.37e-105	672	958	2	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	7.71e-98	49	418	1	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS39875.1	5.70e-197	28	964	33	916
SDU53443.1	1.47e-179	43	958	52	983
QAV17876.1	1.53e-168	40	963	43	1084
SDT55294.1	9.62e-156	43	958	51	909
QNU66099.1	1.01e-151	16	442	15	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	9.29e-119	48	423	12	411	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	1.22e-109	43	418	32	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
3EBV_A	2.04e-108	671	958	5	289	Crystalstructure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
6KST_A	1.26e-104	48	431	7	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	6.78e-104	48	431	7	370	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.14e-114	48	423	44	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	4.37e-74	31	432	17	406	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	6.41e-72	53	432	43	399	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
E9ERT9	1.59e-69	53	432	44	400	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
P32470	2.03e-68	53	436	43	401	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000435	0.998811	0.000244	0.000173	0.000161	0.000154

TMHMM  Annotations     

start	end
11	33