CAZyme Information: MGYG000001543_01738

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_01738
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000001543_7|CGC2	45508.92	9.3643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 54063; End: 55241 Strand: +

Full Sequence      

MGAIKRETKRKLLSLIHDAQARVDKIKVNGLLKNYSTNVIKNEKPLQVKSIVFIITRMVR
FHGGQTSILRLGTELSKLGYNVGYAVYKAQTKEEMELCARSNLESFQGKLYTMYDLDDLK
NILNPDVVIATSWDTVSFAKQFRSYRMYFVQDYEPYFYPFGEQFLLAKKTYEQGLHMVSL
GSWNKMMIETNCSPVSPIDVVEFPYEKKEYPLKNRQYEDYKSKKQFVIAVYLKYYGKRLP
CILQYMLTEVQNMFAKDGITLDVQYYGEAKSFKAKGGKNLGMLNKKELLELYQRADFGIV
ASMSNVSLVPYEMLATGLPLIEFKDGTFDYFFPDNCAALVDISPNDLYIKMKECIQNPEI
MRIRQENANAYLKTLSWEKTGKEFSQILKRLI

Enzyme Prediction     

No EC number prediction in MGYG000001543_01738.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.01e-12	51	389	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.91e-09	278	392	260	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03821	GT4_Bme6-like	9.84e-06	51	384	2	375	Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.
cd03794	GT4_WbuB-like	1.05e-04	270	379	264	385	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03809	GT4_MtfB-like	3.77e-04	280	383	255	359	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43894.1	6.72e-182	1	391	1	391
QHQ63593.1	8.66e-175	11	392	2	379
BCJ96280.1	8.71e-175	15	392	16	389
BCJ97627.1	4.25e-167	9	388	10	385
QLY79141.1	2.68e-129	40	391	36	385

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_01738.