CAZyme Information: MGYG000001543_02265

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_02265
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38609.96	4.5704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 689202; End: 690233 Strand: -

Full Sequence      

MSSIIYVSNENPEKYPNDYHTVADAIASIPDDNKEPITIYIRKGTYKEKLVINKPYITLE
GEDVEETILTYDDYADMIMEDGSKRGTFRTSSVFIDTHDFTAKNILFENSAGFGKDVGQA
LALYVDGDRIIFDNCYFIGSQDTLFTAPLPPTAYQAGGFTGPKEFAERINGRHYYHNCFI
RGDVDFIFGSATAYFDQCEIFSQKTDSLPPAIKEEDQKVYGYVTAASTAEGQEYGYVFNN
CTLTSNCPKKSVYLGRPWRSFAKTIFMNCDLGAHIKDEGWHDWNKLDAHDTILYAEYNNT
GEGAKAIAEGKRAPFSKQLTDEEALHYTKEKVLAGNDGWNPCL

Enzyme Prediction     

No EC number prediction in MGYG000001543_02265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	334	5.4e-98	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.84e-71	18	336	93	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.75e-68	18	336	11	298	Pectinesterase.
PLN02773	PLN02773	3.62e-65	18	327	16	290	pectinesterase
PLN02682	PLN02682	2.26e-61	2	324	68	352	pectinesterase family protein
PLN02432	PLN02432	1.58e-57	18	339	22	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41678.1	1.35e-190	1	343	1	341
SET76962.1	6.66e-131	18	341	11	321
ACZ98654.1	3.32e-130	18	341	13	321
ANU50094.1	1.28e-128	18	341	26	348
QQR01004.1	1.28e-128	18	341	26	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	3.37e-40	19	343	18	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	4.29e-37	18	335	14	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	4.48e-37	18	335	18	304	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	3.87e-36	19	343	18	341	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	1.46e-35	19	343	18	341	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	5.58e-52	21	339	94	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	1.33e-50	18	327	16	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	3.29e-45	19	341	268	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O23038	6.47e-43	19	339	101	387	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
O23447	1.17e-42	21	341	404	692	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000046	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_02265.