CAZyme Information: MGYG000001543_02419

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_02419
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		86181.75	9.5261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 863481; End: 865784 Strand: +

Full Sequence      

MNRNYFKRFKNNSLKQPMKSLVTLCICMILIATCIMQPLPVLADESTSNDNAAAKSTVRT
KNQGVLHAFYPANATFSEKMQTYIDNLDSISFAWSRIDAKDSSSLNTVKGKNGNYGFYYP
NDYLKPLEYAKSQGKSIQLSIYMDGSDCVKLLPEESSRSAMVSAIVNAMQEDLSLGSGLY
YDGAVIDFEGLRNTDGNNKSILYYGKPISDYYIQFLRELKNEFDLIGKKLYVAVNPGLYY
DGYDYTNILTIADRVILMAHDYEPTGKLQKYQIEQYTGYDVLEPINSLAPIEMVRKALNE
IQSAATDSTQLSKVWLQITFDAAQWQFDVKSAKDWETLADTTLSRSKRLTPLYKSIKERV
DNTDGNGVNISYGYNNELQSPYIQYYNKADKSYNVIIYEDSNSISAKIDLARTYNLGGIS
LWSLSNLPDYNDTTGKKFYLNGWDTIISKMISYDKLPTGSSKYVSFTDATVEKAIREKLG
KASGKISTYELQNIYRLKLSTGVKSLKDLSKLTNLEYLDASGLNIKDITAIGKLTKLRVL
YLQRNAISNITALKNLKDLEVLSLNGNQLVYINTLTSLTKLQKLYLRENKIINITALNKL
TNLETLELGKNSIQKIDSLKKLKNLKYLALDNNQVSDLSALKALTNITYLDLSNNKISSI
KAIKSLSGLESLYLQRNTISDISTVSAFKKLKSLSLNGNNISDLKPLAKLTLLEKLYLKD
NKVKSIASLKGLVNLNELYLSGNAITNYSAVKAVYNKKGFLCDFKIN

Enzyme Prediction     

No EC number prediction in MGYG000001543_02419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	100	427	9.5e-27	0.8682432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00033	LRR_RI	5.25e-43	515	747	1	229	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
NF033189	internalin_A	3.02e-39	466	754	47	315	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
sd00033	LRR_RI	5.82e-38	509	732	19	238	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
NF033189	internalin_A	6.88e-38	491	720	184	413	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
NF033189	internalin_A	1.08e-36	491	749	140	398	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42184.1	4.27e-256	2	527	5	532
AEY67763.1	7.86e-149	66	525	38	481
ACL77187.1	1.53e-145	60	525	32	481
AOT70741.1	6.03e-64	66	447	88	469
AUS96550.1	3.18e-52	62	449	216	587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.017819	0.978748	0.002526	0.000335	0.000270	0.000267

TMHMM  Annotations     

start	end
21	43