CAZyme Information: MGYG000001543_02504

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_02504
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902	MGYG000001543_7|CGC11	102924.19	6.2007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 966094; End: 968802 Strand: +

Full Sequence      

MSGYKFKDRYGTFHIDNPEQTGYLYFPLAGEQGIKSAITPTLGGDCKLDQNHFLLQPVSA
EDLHNNKSTRNFWCDIKGKGIWSATGVSSHNMSKRFDSMDEEKEVTELEAGILWHKMKRT
SKEFSLSSEILSFVPVSEEQVEIMSVTIRNIGTIPCEITPIAAIPIYGRSADNLRDHRHV
TSLLHRIATKDESIIVKPTLSFDERGHQVNEMSYYVSGVTGECEKPMGFYPIVEDYIGEG
GSFECPEAVFRKKYCILKGMEFEGYEAMGGIRFKDIALAPGESKEFVILLGMGQDENSYK
QALNSFGTSDKVKKALDVQQKHWKKRLNVSYRTGDSEFDNFMYWVSFQPILRRIYGCSFL
PHHDYGKGGRGWRDLWQDCLALLMMNPEGVKEMLLDNFGGVRMDGTNATIIGSKQGEFVA
DRNNITRVWMDHGLWPLITTALYIEQTGDVSVLLEEKSYFKDKQVCRGTKIDDNFLNQGE
PIQKDLKGNIYYGTILEHILVQTLTCFYEVGEHNHMRIRGADWNDALDMANERGESVAFT
AAYAGNLFTLARLLKCLLKDYGMENVLVAKEMELLFTDQSTLYKSIRMKKSLLDSYCESC
KHTISGEKVRIKTELVIAGLENKAMWLQEHIRKTEWIQVDESGWFNSYYDNHGQQVEGKT
EHGIRMMLTGQVFTIMSGTATEEQVGEIVASADKYLYKEDVGGYRLNTNFHEMKTDLGRM
FGFAYGHKENGAVFSHMTTMYANALYNRGFAKEGYKALNALYKQSINFNKSKIYPGIPEY
FNDRGRGMYHYLTGAASWYMLTVITQIFGVKGSLGALSIMPRLMAKQFDAEGRAEISLPF
GERLFNIVYVNETHKEYGEYRIGDVYLDGNRINLQENNILLQKEQIELLDKESEHQIIVW
LI

Enzyme Prediction     

EC	2.4.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	118	897	5.3e-157	0.6428571428571429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11749	GH94N_LBP_like	3.29e-122	72	302	1	229	N-terminal-like domain of Paenibacillus sp. YM-1 Laminaribiose Phosphorylase and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes bacterial laminaribiose phosphorylase. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Bacterial laminaribiose phosphorylase phosphorolyzes laminaribiose into alpha-glucose 1-phosphate and glucose, but does not phosphorolyze other glucobioses; it slightly phosphorolyzed laminaritriose and higher laminarioligosaccharides. The GH64N domain, as represented by this model, is also found at the N-terminus of GH94 members with uncharacterized specificities.
COG3459	COG3459	6.77e-43	126	872	386	1033	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.04e-27	322	811	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11746	GH94N_like	5.37e-12	107	291	22	178	N-terminal domain of glycoside hydrolase family 94 and related domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-), amongst other members. Their N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. This GH64N domain also occurs in tandem repeat arrangements (not at the N-terminus) in cyclic beta 1-2 glucan synthetase and related proteins, and as a standalone domain in distantly related proteins of unknown function.
pfam06165	Glyco_transf_36	2.66e-07	120	291	87	247	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63065.1	0.0	1	902	1	900
BCN32200.1	0.0	34	901	1	864
QEH67127.1	0.0	1	895	1	892
ADZ85666.1	0.0	1	895	1	892
QCJ05888.1	0.0	1	897	1	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GGY_A	9.48e-315	1	901	5	908	Paenibacillussp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GGY_B Paenibacillus sp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GH2_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH2_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH3_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1],6GH3_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1]
3QDE_A	1.10e-27	9	873	2	791	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3RRS_A	1.11e-18	129	823	116	761	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	4.39e-18	129	823	116	761	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
1V7V_A	1.24e-14	270	821	246	737	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	3.85e-19	193	875	179	795	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	6.74e-14	270	821	246	737	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	1.61e-11	270	825	246	741	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q7S0S2	4.79e-11	238	823	232	731	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_02504.