CAZyme Information: MGYG000001543_02522

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_02522
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MGYG000001543_7|CGC12	46722.46	4.3163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 997416; End: 998681 Strand: +

Full Sequence      

MEAKLIGTIDITAAGNGKGLLGDINGDGRMELIFGQADSNIDDRYVPHQITCVTAYNLNG
ILLWQTGTPEETPGGFGSDFPIQIYDIDGDGKLEILCVMNKKFLILDGMDGTVKKSFDLP
GEEAHDCIIIANLQGKERPSDIILKDRYHKMWALDEDFNLLWTHDGNLGHFPWVYDVNGD
GFDEVMAGYDLLDHNGKILWSCKDLDDHADCLWVGDVNGDGKLEIAVGGSVTCLYDIDGN
ELWRYEGSIESQHIALGKFKKNEPGLMIAGLDRIVRGDGYKGQWDGKDGMFLIDFKGREV
WKEDRKTKGWLTIVDTLRNWNGDGDDYILAYRRGGGVNPALYDGDGNIVVEFGADGYVLH
GDLFGRNKEDVIVYTPEKAYIFSGTEYDLSDKPSGVAIPQIKRLYSSTLYPGGEYVTISL
N

Enzyme Prediction     

No EC number prediction in MGYG000001543_02522.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	1.27e-08	22	216	117	367	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96195.1	3.69e-235	1	416	1	416
QKS48749.1	5.25e-195	20	414	2	395
QNK57848.1	8.90e-193	5	415	10	422
QYR23666.1	2.28e-192	2	414	7	418
ANY76765.1	5.14e-191	1	419	1	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	1.93e-09	21	201	119	357	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	1.94e-09	21	201	126	364	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	1.01e-07	21	201	123	361	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.09e-08	21	201	156	394	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	5.50e-07	21	201	123	361	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_02522.