CAZyme Information: MGYG000001543_02634

Basic Information

• Species: Lachnoclostridium sp900078195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium sp900078195
• CAZyme ID: MGYG000001543_02634
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000001543_7|CGC17	37767.95	5.6119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001543	4599950	Isolate	not provided	not provided

• Gene Location: Start: 1154555; End: 1155511 Strand: +

Full Sequence      

MLKEKYKNFFKVGVAVSDKTIESHAEIIKEHFNSITCENEMKYSSVTKQEGIYDFHKADK
IVEFAAENNIPVRGHTFAWHNQTPDWVFEGSKEQLLNRIKSHFAILGERYKEQVYCWDVV
NEAIEDKTGLVMRQSKWVEILGENFMDTIFHMVKEQLPNTELFYNDYNECNIEKQAKTIQ
VIKGMKERGVPIDGVGLQCHHNIYFPSEEDLKRTIEAYADLNMKIHITEMDVSLFEYNDH
TRLLKPSVELLKKQAKTYETAFRIFREYKDYIDCVTLWGVADDVTWLDNFPVRDRKNWPL
LFDEEHRPKEAYYRIMDF

Enzyme Prediction     

No EC number prediction in MGYG000001543_02634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	2	317	8.4e-106	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.30e-112	2	317	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	4.79e-108	41	315	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	4.45e-86	25	318	51	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43367.1	8.61e-130	2	318	4	321
QIK52226.1	3.55e-121	2	317	10	334
AZP05644.1	2.82e-120	2	318	3	326
ACW01951.1	1.22e-118	2	318	13	336
ACP87323.1	1.22e-118	2	318	13	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L4O_A	1.60e-117	2	318	13	337	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
2Q8X_A	2.02e-117	2	316	8	329	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	2.86e-117	2	316	8	329	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
4PMD_A	1.03e-116	2	318	13	337	Crystalstructure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose [Caldicellulosiruptor bescii DSM 6725]
3EMC_A	1.15e-116	2	316	7	328	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23556	4.55e-116	2	318	17	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
O69231	6.54e-116	2	316	8	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	2.16e-106	2	317	8	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q12603	4.98e-100	2	318	35	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	6.27e-79	4	317	47	371	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001543_02634.