CAZyme Information: MGYG000001544_00250

Basic Information

• Species: Corynebacterium bouchesdurhonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium bouchesdurhonense
• CAZyme ID: MGYG000001544_00250
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		30476.89	5.2785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001544	2255536	Isolate	not provided	not provided

• Gene Location: Start: 4339; End: 5211 Strand: -

Full Sequence      

MTNQRAPLPPRAPSAHSAQSTPSGPSRRRRAARGCGCVGLVAVTLAVVLTVAVVAWLLSI
NQAPGPGQQQEPAPATMPPAAAPNPPAIDVNAPGRTSDQLAEWAAPISEQTRIPAQALRA
YGNAALIAQESWPACHLHWNTLAGIGWVETRHGTYSGRFDSSALNAQGIPEPEIIGPALD
GTGGFLLVDDTDAGALDHDTRFDRAVGPMQFIPESWGRYGRDADGDGAANPQQIDDAALG
AANLLCAFGRDLDTEEGWRGAIASYNHSSDYLAKVRDAAANYAMNQPAHR

Enzyme Prediction     

No EC number prediction in MGYG000001544_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	137	283	3.5e-19	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	6.01e-28	88	283	73	276	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	9.58e-22	135	280	1	107	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	1.88e-04	205	249	155	200	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ15804.1	3.63e-128	43	290	20	268
AKV59750.1	4.36e-127	43	290	21	269
QQU84026.1	3.56e-126	43	290	21	269
SNV78318.1	1.14e-119	43	290	19	267
AIJ33996.1	1.14e-119	43	290	19	267

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999860	0.000153	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
36	58