CAZyme Information: MGYG000001544_01639

Basic Information

• Species: Corynebacterium bouchesdurhonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium bouchesdurhonense
• CAZyme ID: MGYG000001544_01639
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		40776.11	8.7778

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001544	2255536	Isolate	not provided	not provided

• Gene Location: Start: 732904; End: 734058 Strand: -

Full Sequence      

MSLKRTVTATLAAAAVSLSALGAVATAPSAGAAIPAAQVAGQTPVGTVKAWDAPRSPSLV
AGTTKPQDWVQQVDHKTVLSYKVYSPSMRRDIPVAVIPATNAQGQRVSGAPTVYLLNGAG
GAEQNQDWLKMAPVKEFFAGKGVNVVIPQAGAFSYYTDWLDDTMNTAYLQGPQKWETFLA
KELPGPIERTLGADSRRAIVGFSMSGTSALVLPEHYPGFYNAAASFSGCAATSSPAGYNF
ARLTVNRAGNSDFTTITPERMWGPMNGPYNRWNDALVNAERLRGTALYISTATGLAGRPD
QVGYLLGLGAPDGVAQVASAKLQVEGGVIEGAINQCSHDLRAKLEGLNIPATYEFRNVGT
HSWPYWRDDLQKSWFTTIAPAFGM

Enzyme Prediction     

No EC number prediction in MGYG000001544_01639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	85	374	1.6e-47	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.20e-50	84	384	46	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	4.52e-24	85	370	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOX06778.1	2.43e-186	5	384	6	378
AKK10240.1	3.72e-105	81	383	66	371
QVI99079.1	1.21e-99	69	374	56	346
ASF07874.1	1.50e-76	83	384	65	349
AFU01650.1	5.96e-76	83	384	65	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H18_A	2.94e-100	20	384	17	363	Threedimensional structure of corynomycoloyl tranferase C [Corynebacterium glutamicum ATCC 13032],4H18_B Three dimensional structure of corynomycoloyl tranferase C [Corynebacterium glutamicum ATCC 13032],4H18_C Three dimensional structure of corynomycoloyl tranferase C [Corynebacterium glutamicum ATCC 13032],4H18_D Three dimensional structure of corynomycoloyl tranferase C [Corynebacterium glutamicum ATCC 13032]
7MYG_A	4.40e-26	82	370	8	265	ChainA, Diacylglycerol acyltransferase [Mycobacterium tuberculosis],7MYG_B Chain B, Diacylglycerol acyltransferase [Mycobacterium tuberculosis]
1DQZ_A	4.58e-26	82	370	10	267	ChainA, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis],1DQZ_B Chain B, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis]
1DQY_A	4.85e-26	82	370	13	270	ChainA, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis]
4MQL_A	5.22e-26	82	370	14	271	ChainA, Diacylglycerol acyltransferase/mycolyltransferase Ag85C [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1D7	1.49e-27	111	384	139	388	Protein PS1 OS=Corynebacterium melassecola OX=41643 GN=csp1 PE=4 SV=1
P0C1D6	6.71e-27	111	384	139	388	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1
P0A4V5	9.92e-25	82	370	58	315	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fbpC PE=3 SV=1
P9WQN8	9.92e-25	82	370	58	315	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=fbpC PE=3 SV=1
P9WQN9	9.92e-25	82	370	58	315	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fbpC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000592	0.997685	0.000266	0.000970	0.000258	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001544_01639.