CAZyme Information: MGYG000001544_02097

Basic Information

• Species: Corynebacterium bouchesdurhonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium bouchesdurhonense
• CAZyme ID: MGYG000001544_02097
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		56224.82	9.8946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001544	2255536	Isolate	not provided	not provided

• Gene Location: Start: 361498; End: 363021 Strand: -

Full Sequence      

MSVPWSKRDTTAALVLGALALFTRFLGLLQPTSSGTPVFDEKHYVPQGWDMVRSSINPVL
GGIESNPAYGLVVHPPLGKQLLAFGETFFGYTPLGWRVMTALFGAAVIVFTFLLGRRVSQ
STTVGIFAGAIALFDGVLLVSAKFGMLDMFEVLFIIAAAWTLAGDMRQVHQRWHGAWLAG
EVAAAGPLGPRVGFRWWRFATGVLLGLALSVKWSGLYYMAFFGLLGSFWDLWLRKRYGVE
KPLAGALLRDVPSALASIVLVPLLLYAWSWRAWFASETSVYRHSLADGSIAASDWPWLSH
LPEPIAGWIYYHLSVAEFHASLTSSSGHSHPWDSKPWAWLVGARPILYYSATDLDCGRLG
TCREMIFLFGTPPIWWLTVPVLLWAGWVWLTRRDFRVIVPLIGFAAGFLPWLAAFDRQMY
FFYATALAPFTAVLIALALGNIAQRGEPVRSGVIRKLAGTTPRTGQVVVVAYLAVVAAAF
LYWSAILYGFRVPEGFYQSIMWLPSWK

Enzyme Prediction     

No EC number prediction in MGYG000001544_02097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	18	274	6.7e-60	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	5.98e-44	23	506	53	693	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	8.32e-12	22	232	9	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	2.38e-11	74	451	136	421	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	6.06e-07	308	504	3	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4745	COG4745	2.18e-04	60	315	55	301	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYH20047.1	0.0	1	507	69	575
QQU83129.1	0.0	1	507	21	527
AKV59878.1	0.0	1	507	30	536
AQQ14755.1	3.91e-317	1	507	12	518
AOX06720.1	4.92e-315	1	507	12	518

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	5.28e-222	5	507	30	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	1.73e-131	19	507	53	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.73e-131	19	507	53	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	6.47e-130	15	507	43	516	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q9W5D4	4.50e-06	60	233	74	247	Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998419	0.001559	0.000012	0.000005	0.000004	0.000039

TMHMM  Annotations     

start	end
12	34
94	116
123	142
147	164
203	225
251	273
366	388
398	415
420	442
468	490