CAZyme Information: MGYG000001544_02158

Basic Information

• Species: Corynebacterium bouchesdurhonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium bouchesdurhonense
• CAZyme ID: MGYG000001544_02158
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		27379.23	8.1339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001544	2255536	Isolate	not provided	not provided

• Gene Location: Start: 422469; End: 423236 Strand: -

Full Sequence      

MLNIALVVPCLNDADLLARCLASFRAQTRPLDQIIVVDNGSTDASAAVAASFGAVVVGEP
RRGITWAARAGYDAALAGGADLIVRTDADAWASPTFVEELVRQFALLIDASAQRTSTSPV
GLTGAATFDLPVGGALLARLYLGAYRASVGSALGHPPFFGTNCAFFARWWGEVRDAVDSA
DTFVHDDIQLSFAVRPHETVLYAPQLSVCMDARALRGAAQLRTRFRRGWYSMLRGFQTSP
PPRRLLARWAGPREA

Enzyme Prediction     

No EC number prediction in MGYG000001544_02158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	104	1.2e-19	0.6

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	7.83e-21	7	112	2	110	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	2.65e-19	1	100	2	104	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	2.24e-18	7	104	3	103	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02511	Beta4Glucosyltransferase	3.55e-14	3	105	1	97	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd02525	Succinoglycan_BP_ExoA	7.28e-14	4	102	2	104	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDL61960.1	1.29e-98	3	248	8	249
QDR76619.1	1.34e-90	3	248	5	247
QPK83888.1	7.81e-85	3	248	5	247
AKK04975.1	2.46e-80	3	248	8	250
QGU07411.1	3.27e-80	3	253	12	257

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A598	4.90e-06	4	89	6	84	Uncharacterized glycosyltransferase Mb0553 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB0553 PE=3 SV=1
P9WMY0	4.90e-06	4	89	6	84	Uncharacterized glycosyltransferase MT0564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0564 PE=3 SV=1
P9WMY1	4.90e-06	4	89	6	84	Uncharacterized glycosyltransferase Rv0539 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0539 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001544_02158.