CAZyme Information: MGYG000001545_00420

Basic Information

• Species: Olegusella massiliensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olegusella; Olegusella massiliensis
• CAZyme ID: MGYG000001545_00420
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1366		156417.72	6.292

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001545	1806744	Isolate	not provided	not provided

• Gene Location: Start: 406660; End: 410760 Strand: +

Full Sequence      

MPKVSVIIPIFNAEEYLDECLKSVLSQTLSDIEVICVDDGSSDSSLTILNKYAKNDSRIK
IIEQKNAGAGAARNRGMEIATGEYLSFLDSDDVFELTMLEKLVAISDFEQLDVAICRCNK
FIHETKETIDTPWTIKSELIPANNYFQATDIKKDFFEAFIWWPWDKLFRAQFIKDSSLYF
QEQRTTNDLFFVVGATLLANKIDYINDILIHQRVHEGSLAVTREKSWHCFFDALIKVRDF
LQEKKLYDRFEQDFINYCVTFTNWYKNSIDISTYQKIVPALSRAFKELGVADKPRKFFYE
TDSWSEVQKVLNWKTIAISVIMPSLNVRPYIRECVQSVCNQTLRNIEIICVDAGSTDGTL
EILREFEKNDPRVTVIVSDKKSYGHQMNLGLKHAQGEYIGIVETDDFASPTMYANLFAVA
EKRDADVVKANWHRFQTKPIQHDILFERYAGIPYNKVLTVGEKKKLLDGASGIWSGIYRK
SFLARNEIDFLETPGASYQDTAFLLKVIMAAQSIILLKKGWLHYRIDNDNSSVHSSGKVF
CVCDEMKSVHAYINARPALKKTYQADIWSRTATVYDWNDKRLADSLRIDFLKEVQAEFTQ
GLESGSFKLDYLTGRYRGFIEQVLESPESYVAHHKTISQKFELSNPKNSPLFTIVLEVRN
GEKTLRTCLDSLHAQTFSSFEVLCFDQNSLGNTGTILAKYAHEDSRFQVISDGGESLRNT
AINKSQGAFILFINNYTFLQPSCLELLGEIIETQSPDILLNKQTCYNLDSKKLAQESFGY
NEAIYSSIYPFNSTTAPKQLLQVTSPSVLGKVYRTDFLKSLFYQFETNTSFRNDALLCSI
ALLQASKISACDTAVIVQASTSKERKENHINPYASELAKPWIDLLGANGVFASNKYNNPL
VLSSARALAAHTIRSDFDLLTSNDARSIAVHALSSGAVRSTGVFDLAYESYEEEADYNFF
QGVRAGFEKISSSEERSEIIVIPRKSMTQPSISVVVPIYNSEKYLSECLDSLVNQSKNDI
EIICVDDGSIDSSSELIKNFAENDPRIILLHQENQGQSVARNTGVGYSVGRYIYFIDSDD
VLDIYALEKLYTKMELEKLDVLFFEGISFAHSTDDIETYQHFEGNYQRHYLHSDVLNGPT
LLKELWNDGDYWVSPCMQMTRREHFINNNLWFLPGIIYEDNFYTFKSLLHARRANCIHDS
LYKRRVRSGSTMSGKLKFFNCYSYFKIFLAMSDEISAHSPEDEGWAVACELREYMLQHAR
AQFSKLSSIEQNERWFMPELELYLFEKNITSYCELKEIIKAQNDEINTLNRLAASNLRAA
NRLQDRLSQIKSNKIIKLGLRLRRFLRRARRALRNPKLILRKLGLS

Enzyme Prediction     

No EC number prediction in MGYG000001545_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	130	3.7e-35	0.7470588235294118
GT2	993	1130	6e-35	0.7764705882352941
GT2	319	438	1.8e-29	0.711764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10073	PRK10073	2.45e-42	2	218	6	221	putative glycosyl transferase; Provisional
PRK10073	PRK10073	7.09e-40	990	1241	6	255	putative glycosyl transferase; Provisional
pfam00535	Glycos_transf_2	5.50e-36	5	127	1	124	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.16e-35	6	123	1	120	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	7.87e-35	993	1165	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDG65555.1	5.51e-125	2	629	247	890
QTU83702.1	1.12e-76	2	666	3	681
VDY64027.1	4.60e-76	2	275	6	281
AFJ46559.1	4.60e-76	2	275	6	281
QUF80655.1	2.22e-75	3	310	4	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.43e-28	4	223	7	226	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	4.29e-26	1	92	4	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z86_A	1.79e-17	1	100	374	473	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.79e-17	1	100	373	472	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
5TZE_C	3.87e-17	3	281	2	278	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71057	1.44e-33	2	259	4	259	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P71059	3.77e-30	1	220	2	219	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
A0A0H2UR96	1.34e-26	992	1212	5	222	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P11290	1.93e-25	992	1210	8	221	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
A0A0H2URH7	1.37e-24	987	1210	2	221	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001545_00420.