CAZyme Information: MGYG000001546_00615

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_00615
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43491.68	4.7862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 739247; End: 740401 Strand: -

Full Sequence      

MLLFSLLLSVVACSDDNEGPKKEEGNDPVTLTLSDPNATEETKALYSNLWAIQSKGFMFG
HHDDLMYGRTWYGTEGGSDTKAVCGDYPAVYSLDFAEHIDDRYASDPDAQALRLRCCREA
YDRGMVLTSCIHINNPLTGGDSWDNSSNRVVAEILTEGSTTNKTFKEWLDRLADIAHNLR
GSDGKLIPVIFRPFHEHTQTWSWWGASCTTTEEFINLWKFTVKYLRDTKGVHNFIYAISP
QMDSAKTVDDFYFRWPGDEWVDFVGMDCYQGINNAVFVTNLKAISKVSLAKLKPCGVTET
GVEGFSATDYWTTNIHAPLTGRRVSMVVTWRNKYDPMESGTHYFSVFPGHPSERDFVKMY
NQENSFFCNDLPDMYTPAENVTVL

Enzyme Prediction     

No EC number prediction in MGYG000001546_00615.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	34	363	8.3e-61	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.08e-34	35	269	2	230	Glycosyl hydrolase family 26.
COG4124	ManB2	8.25e-15	132	310	128	303	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB80106.1	2.35e-191	2	383	5	387
ALJ40168.1	1.17e-178	2	383	5	392
QUT88729.1	7.04e-177	1	383	6	389
ALJ60278.1	1.42e-176	1	383	6	389
BBL06287.1	3.17e-172	29	383	76	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.45e-75	39	375	9	343	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	1.46e-63	9	375	8	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	1.46e-63	9	375	8	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	2.64e-63	9	375	31	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.13e-62	9	375	8	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.22e-51	4	375	16	415	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	6.04e-37	18	304	30	321	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.12e-13	30	317	28	310	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	1.99e-09	160	301	277	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	9.89e-09	29	269	170	394	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000384	0.177184	0.822223	0.000078	0.000072	0.000064

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_00615.