CAZyme Information: MGYG000001546_00762

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_00762
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001546_5|CGC13	42521.31	7.2375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 936324; End: 937481 Strand: +

Full Sequence      

MLLGMMPAAEAAAASTAAGESGGSVRNSASAAPVVSEAVTVYAEGEKGYAGFRIPVVIRT
NDGALIAFAEARRNDKRDSGDIDLVMRRSEDDGHTWGPITTVWDDDGNTCGNPAPAVLDG
GRIVMLATWNRGCDRERQIEQRTSVDTRRVFVLRSEDHGRTWSRPEEITSGVKDPDWTWY
ATGPCHAIVKRRAPHKGRIVVPANHKRLENGGHVESYSQLLYSDDEGLTWQSGAVSQRGG
NESTVAELADGSLLLNMRHYERGDSLRLYAVSRDGGTSWNVQGEHSELVEPRCQGSLLNL
THGGRPTRRLLFCNPHDARRRRNLSLCESRDNGRTWRHLTTVCPGPSAYSDLVRLDRNRV
GVLYENGDADDLYRRISFTVVTLRP

Enzyme Prediction     

No EC number prediction in MGYG000001546_00762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	39	379	1.8e-90	0.9678362573099415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.19e-98	39	382	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.53e-32	63	362	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	2.85e-08	43	365	350	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd00260	Sialidase	2.87e-05	52	184	15	143	sialidases/neuraminidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed beta-propeller fold. This hierarchy includes eubacterial, eukaryotic, and viral sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD46002.1	5.62e-106	41	378	39	367
QQL50302.1	2.08e-101	41	383	36	374
CAZ95099.1	4.72e-99	41	367	42	364
QEC45250.1	6.40e-99	36	381	93	433
ASO04237.1	6.68e-99	41	383	42	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	3.89e-38	39	377	168	516	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MNJ_A	2.60e-37	45	369	193	525	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MYV_A	2.59e-36	39	384	168	518	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	3.45e-36	39	384	189	539	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
7LBU_A	1.24e-33	33	365	79	413	ChainA, Exo-alpha-sialidase [Cutibacterium acnes],7LBV_A Chain A, Exo-alpha-sialidase [Cutibacterium acnes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	1.62e-31	39	377	190	538	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
A6BMK7	3.95e-28	52	367	77	396	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2
Q02834	5.99e-28	9	367	21	388	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
Q4WQS0	6.63e-28	48	384	54	393	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2
O35657	8.72e-27	52	367	71	390	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.763032	0.236423	0.000126	0.000186	0.000118	0.000117

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_00762.