CAZyme Information: MGYG000001546_00947

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_00947
• CAZy Family: GT80
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501		56228.98	4.2535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 1172116; End: 1173621 Strand: +

Full Sequence      

MKRLFRLFPVFALLTGVWACSDDKTSEVRINDGTEFLSLDYLARSGKITVTAPGPWSITL
PEEGGGNDWFTLSPLSGPEGYSEIEVTLEANAGEARSALLTFVCEGKSYPFQLSQSAKDA
GFDSPDYYFYAAFGTMPALYSGLHLLSHDKPSYFFYERPQTYDPKLFPDYATVFTAANPN
AGATTEEIYAMSEQMKRRILEINAEDPTAVFGLYVTDLVCRAGYDWFVGQGIDSARVKVT
MLSDGTGTYNNFHTFFGDPATAEQNWNDYAAQVEALDWDHGGRYPETRAPQSLVSDEWIA
YLSTRPNYRLMLQNASLMESSGPFMTEKLAEMKMESVQPYELLTALPENAKQEFYRMANF
SYDQFKALFDASPKGNLIILGTSHTTDESRQQQAAYVRRIMDQYGSEYDVFFKPHPADNS
SSDYEERFPGLTLLPGQMPFEIFVWSLLDEVNLIGGYPSTTFLSVPLDKVGFLFATDAAS
LPRPLNLLFSDAPNVEWMQQP

Enzyme Prediction     

No EC number prediction in MGYG000001546_00947.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT80	338	479	4.7e-36	0.39841688654353563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14948	BACON	4.85e-13	34	116	6	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam11477	PM0188	3.86e-04	405	476	284	355	Sialyltransferase PMO188. PMO188 is a sialyltransferase from P.multocida. It transfers sialic acid from cytidine 5'-monophosphonuraminic acid to an acceptor sugar. It has important catalytic residues such as Asp141, His311, Glu338, Ser355 and Ser356.
pfam13004	BACON	6.04e-04	62	116	4	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01105.1	7.60e-245	1	499	1	498
BBL09010.1	1.21e-90	311	499	1	189
BBL11802.1	1.21e-90	311	499	1	189
AWK81336.1	1.27e-08	239	481	224	467
BAA25316.1	6.18e-08	339	481	315	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R9V_A	1.48e-09	339	481	224	376	Crystalstructure of sialyltransferase from photobacterium damselae, residues 113-497 corresponding to the gt-b domain [Photobacterium damselae]
4R83_A	1.86e-09	339	481	321	473	Crystalstructure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_B Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_C Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R83_D Crystal structure of Sialyltransferase from Photobacterium damsela [Photobacterium damselae],4R84_A Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_B Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_C Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae],4R84_D Crystal structure of Sialyltransferase from Photobacterium damsela with CMP-3F(a)Neu5Ac bound [Photobacterium damselae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000115	0.045308	0.954526	0.000025	0.000029	0.000023

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_00947.