CAZyme Information: MGYG000001546_01116

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01116
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000001546_5|CGC19	46391.31	9.3162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 1405840; End: 1407036 Strand: -

Full Sequence      

MKKFLLAVQTLLLLAAASNVRAQKSYDLKHFPKGCQPEEIGVRLTERYLQTPHSHWGDIN
SKYKVTLVTYPDVCAWLGALWFTTGTGNDSLYTRLVERFEPLFTTQKNLQPNLFPKDHNV
VDFYVFGAVPLEIYKRNHDPKYLELGMKYADGQWELPADPKLYKQLSEAKKYADEGYSWQ
TRLWVDDMFMITDLQAQAYLVTGERKYIDRAAREMALYLDRIQRPNGLFYHHTGTPYFWG
RGDGWMAVGMAEMLRMLPKDNPYLPRIKAAYLQMMETLLRYQAYDGMWRQIIDNPNSWKE
TSSTAMFTYAMILGVKNGWLDRKIYGTAARKAWITLLSYLDEKDNLRNVCEGTGAKNSFD
WYQNRRRLTGDLHGQAAMLWCAYALSCDVKPYKPARNR

Enzyme Prediction     

No EC number prediction in MGYG000001546_01116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	68	384	7.1e-65	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.17e-44	133	383	84	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.28e-37	131	379	46	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH42438.1	8.78e-183	25	390	41	404
AWO00682.1	4.93e-175	25	391	41	405
SCD21779.1	6.26e-163	24	388	40	387
BBE16470.1	1.96e-157	1	385	1	373
ALJ58453.1	4.01e-153	27	385	27	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	5.89e-27	113	379	81	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.49e-26	113	379	71	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	4.88e-26	183	380	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	6.24e-19	140	356	92	327	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	7.64e-19	149	356	124	344	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.22e-26	113	379	81	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	2.71e-15	167	333	184	362	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	5.57e-15	107	363	62	313	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	4.20e-14	168	336	141	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.36e-13	149	333	161	327	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999019	0.000177	0.000175	0.000167	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_01116.