CAZyme Information: MGYG000001546_01611

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01611
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230		25670.21	8.3985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 2010845; End: 2011537 Strand: +

Full Sequence      

MLKKTVLTFAFLTILTTFYGFNAQFSAPATGNALNAEAAMDYSLLPEGSYLISAYDNLIR
SISEQEGHDWRLMSAIAYHESRFTPDITSRSGARGLMQIMPSVARQFDVPVTEVSNPETN
IWLANKLLSKIMSTLRLPEGISEKDRMSIVLASYNSGIGHVSDARRLAKLNGENPNSWEV
VARYLSLKADPAYYESEVVKCGRFTGSRQTLAYVNDVIGRYDRYCRVAGR

Enzyme Prediction     

No EC number prediction in MGYG000001546_01611.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	67	224	1.7e-22	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.32e-66	59	226	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	9.66e-34	69	196	283	406	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	1.75e-31	43	194	285	423	membrane-bound lytic murein transglycosylase MltF.
pfam01464	SLT	2.69e-22	59	169	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	6.40e-20	54	178	5	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK65133.1	9.17e-146	1	230	1	230
BBL08197.1	1.67e-137	1	230	1	232
BBL10988.1	1.67e-137	1	230	1	232
BBL00117.1	1.67e-137	1	230	1	232
AFL78639.1	1.73e-134	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	1.68e-21	55	222	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.68e-21	55	222	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	2.03e-21	55	222	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	2.03e-21	55	222	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	2.03e-21	55	222	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	2.02e-24	55	222	288	448	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
A5UG36	5.16e-23	18	194	263	422	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltF PE=3 SV=1
P44587	1.32e-22	18	194	263	422	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltF PE=3 SV=2
Q4QNV4	1.32e-22	18	194	263	422	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltF PE=3 SV=2
A3QCH2	3.30e-22	69	222	292	438	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.043528	0.861359	0.093982	0.000414	0.000330	0.000342

TMHMM  Annotations     

start	end
5	27