CAZyme Information: MGYG000001546_01695

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01695
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491		56225.89	5.2711

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 2115064; End: 2116539 Strand: +

Full Sequence      

MNKSLKYLLLIAAAALLAAGCTEDKTYALPEVYPSDGGDTPSDVEPPHEVRARKNKTSAW
GDYLAYTVDRIHGFTPGEDPVTDKYGGWKVSSLQATGFFRTQQIGGRWWMITPEGNLYIC
KGVAVFSAGGSDRQQAKLQEKFGSTSEWARQETSMLKARGFNGLGAWSNVETVRKLTEPM
PYTVIVSPMGKLNSYIKSSGEEAGASWSGWEGYPNDFAMVFHPKFDEYVESEISTISKYK
DDPYCIGYFTDNEIPWKDYALDRCLEKWPETHINHKKAQEWLDQRKGKTGAKLSEATAAD
RRAFIAYCLEIYLEKVTKAIKKYDPNHLYLGCRFNQWNYELVNDEMFKTAGKYMDILSIN
HYQKWEPDAQAVQNWGAWSGKPFFVTEFYTKGEDSELPNTTGAGWNVRTQAERGYFYQNF
VLKLIESKVCVGWHWFTYQDNDPENPNTDPSNRDSNKGMVTWDFQYYSPLLDNMEELNGN
VYQLTRFYDAQ

Enzyme Prediction     

No EC number prediction in MGYG000001546_01695.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	135	482	1.8e-77	0.552833078101072

CDD Domains     

MGYG000001546_01695 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK51715.1	4.11e-176	48	489	29	470
QDW22820.1	1.06e-169	49	491	27	469
AXB55225.1	6.49e-169	49	489	27	467
AWK02836.1	9.52e-169	49	489	30	470
QSW90200.1	7.20e-168	49	491	27	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	3.89e-62	83	489	84	480	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	2.26e-25	80	482	242	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	5.39e-25	80	482	242	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.76e-22	136	482	400	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	7.40e-22	84	483	265	760	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	3.49e-25	85	484	476	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	2.41e-08	144	482	553	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_01695.