CAZyme Information: MGYG000001546_01945

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01945
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000001546_5|CGC33	110435.61	6.9241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 2473836; End: 2476784 Strand: -

Full Sequence      

MTRMCVRTMFLAALLSVCGVAGAIAQISLATGKTAGSQFLLAGKNSGATLYYDDRDFEVV
KRAAGFLSQDIGLVTGRNATVQALPAAKETAIVVIGTLGHNSLIDRLVSEGRLNVDKIRG
GWEQYAVEVVERPAAGIRKALVIAGSDRRGTAYGVFSVSEAIGVSPWYWWADVPVAQKDR
LTLDVKSYRSKEPSVKYRGLFINDEDFGLKPWAAKTFEPELGDIGPKTYSKICELLLRMK
GNYLCPAMHSCTKAFNYYPDNKLVADSLAIVMGSVHCEPLLFNNASEWDRKTMGEWNYVT
NKEGINKVLRKRVEENGVYENVYTLAMRGIHDAVMAGNLTLEEQARVLEKVFDDQRQMLS
DVLGKPADQIPQAFTPYKEVLHTYEHGMKLPDDVTIVWGDDDFGYMKRLSNAEEQKRSGR
SGVYYHLSYWGPPMNFLWINTNPPVQMYTELKRAYDTTADRIWLANVGDIKPAENALSLF
LDMAWDIDAFTVENVGFYYANTLSKYFGAQHRDALQHIFDEYFSLAFARKPEHMQHHLEQ
HFAEDNYHEAERRTARYAAISAEADAIYAQLDEASKPGFFQLVYYPVKGAALLNIAILEA
QRNRWYAAQGRVSANQVRERVNAAIGELRKITKDYNELKDGKWRYMMTLAQGGWGDIYVP
PTKKVEPAAAPGLGIHAESETLHTGMSNLHTLPAFNPFTDKSYYVDVFNTGLGELKWNAQ
PSETWIKLDKTAGSTPYEQRVNVSVDWDKAPKGRSLSARIVFKGAGAEKTVYVSAFNPAE
IVRDSLTGLYVEDNGVVSIDAAGFHRKFERHGIRFDKIARYGFEDTVVQLGDPFAKADFY
PSLELTSNYVAPAPLNRYPMIEYDFYSFTTGPVDVYTYMVPLFPLDNEHGTRYGVMVDKS
PVYLPEAGAPYYSTLWIQSIMRNCRINKTSHMISEPGKHTVRIFAAHPGMMIQKIVIDFG
GMKYSYMGPRPTKVDPKTESEK

Enzyme Prediction     

No EC number prediction in MGYG000001546_01945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	38	666	7.1e-228	0.8436154949784792

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	7.01e-166	191	533	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.05e-45	790	969	2	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd14948	BACON	3.14e-04	717	774	28	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	6.54e-04	717	770	3	54	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR45611.1	0.0	14	975	8	970
QUR45612.1	0.0	19	973	16	982
EDV06188.1	0.0	23	973	20	983
QDO71503.1	0.0	23	973	18	981
BCA48102.1	0.0	39	972	33	979

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	5.29e-158	41	972	16	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	3.33e-125	59	643	39	611	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	4.04e-113	7	662	13	658	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	4.20e-111	38	662	16	643	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	7.96e-111	38	662	15	642	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004968	0.938318	0.055106	0.000902	0.000368	0.000303

TMHMM  Annotations     

start	end
9	31