CAZyme Information: MGYG000001546_01959

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_01959
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		72470.53	6.3509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 2498678; End: 2500603 Strand: +

Full Sequence      

MKTHYWLGLAALCLSALAGCDASHGPKVTPRVADRVTWFSPDEVTLLPGPLLDLQNQGRD
YLLWLQPDSLLHFFRVEAGLVPKAQPYAGWESEDVWGVGPLRGGFMGYYLSGLSLMYRAT
GDERLLRQLEYTLSELEACRKAGGDGYIMAIAGGRELFRRVAAGEIRTDNPTVNGAWAPL
YLINKMLHGLRASYVEAGQRQALTLMTSLADWFGYGVLDKLTDEQVQQLLVCEHGSINES
YLDVYELTGESRYLEWAGRLNDRSMWVPLSEGRDILNGWHANTQIPKFTGFEKFYVHTGD
ERFDRAARNFWEIVTTRHSWVIGGNSTGEHFFPESRFEEKVLKQGGPETCNSVNMMRLTE
ALFAQRPDVRMAEYYERVLLNHILSAYDPCKGMCVYFTPMRPAHYRVYGSEDHSFWCCNQ
SGLETPAKLNRMVFTKQGRDLMVNLFVPAAVTWKERHVSLIQQASMPESPEVTLILKTGR
DRELGLLVRKPSWSPEAVLTLNGRTIAPETDSAGYWVVREPWSGTDTLKIGFSPRITAEK
LPGSERYSALLYGPYVLAGRMGTDSLPASFWRGIDNGANNVIPMPERTFVPWTAETIASH
VVKTGDDPLTFGFEGEGFRGIGIEPFYRIHFERYTIYWPVK

Enzyme Prediction     

No EC number prediction in MGYG000001546_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	558	2.1e-171	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.57e-174	43	558	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.01e-93	44	571	12	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	9.00e-10	593	638	35	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06683.1	3.09e-276	37	640	44	653
QMW85339.1	2.52e-275	21	641	29	654
QQA08878.1	2.52e-275	21	641	29	654
AAO78017.1	2.52e-275	21	641	29	654
QQT79801.1	2.91e-274	37	640	44	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.35e-139	35	637	24	647	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.64e-134	35	637	24	647	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	6.57e-17	180	605	141	598	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.07e-15	180	605	141	598	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000015	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_01959.