CAZyme Information: MGYG000001546_02802

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_02802
• CAZy Family: GH65
• CAZyme Description: Maltose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000001546_5|CGC44	50874.42	5.0641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 3547874; End: 3549208 Strand: -

Full Sequence      

MLLQTYTGVDTRLNIGPKGFTGEKYGGVTYWDTEAYCLPFYMATAGQEVARELLVYRYNQ
LDKAIENAAKLGFRDGAALYPMVTINGEECHNEWEITFEEIHRNGAIAHAIRNYIRYTGD
EQYLADCGLEVLVGIARFWAQRITWSDARGQYVLLGVTGPNEYENNVNNNWYTSYIACWC
LRYAVEAARWVRENRPADYARICAKRAFDEAAETAVWHRIADNMYLGEDRELGIFLQQDG
YLDKEQTLVKDLDPSQRPINQKWSWDRILRSCFIKQADVLQGLYFFGEEFDLDTLRRNFY
FYEPRTVHESSLSPCVHAVLAARLGDMEKAVEMYLRTARLDLDDYNREVAEGCHVTSMAG
SWLSVVEGFGGMRVRDGVLSFDPRLPGGWESLAFKVGFRGRVLTVKVTRTAVEVTNEGDP
VTIALCGERHTVETRIIHPIENNR

Enzyme Prediction     

EC	2.4.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	2	376	4.9e-143	0.978494623655914

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	2	420	325	746	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	0.0	2	440	327	756	maltose phosphorylase; Provisional
pfam03632	Glyco_hydro_65m	1.67e-162	2	379	7	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03633	Glyco_hydro_65C	9.41e-15	383	431	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.
COG3459	COG3459	0.003	331	437	939	1051	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62951.1	1.25e-277	1	437	319	755
ACU62519.1	3.22e-227	2	428	328	755
QHL86664.1	6.96e-226	2	433	328	760
QHS63804.1	7.44e-226	2	428	328	755
AFD07362.1	2.90e-225	2	432	328	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H54_A	3.69e-150	2	427	329	745	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
3WIQ_A	2.76e-82	10	414	322	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	1.99e-64	7	437	309	757	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	5.30e-64	7	437	309	757	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
7FE3_A	8.57e-26	3	392	312	662	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E6ENP7	6.64e-172	2	440	349	776	Maltose phosphorylase OS=Enterococcus faecalis (strain TX4000 / JH2-2) OX=749493 GN=malP PE=1 SV=1
O06993	2.91e-164	2	407	325	720	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1
Q8L164	3.17e-96	2	423	341	759	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	2.39e-78	2	430	324	747	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
Q8RBL8	2.02e-76	2	414	329	751	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_02802.