CAZyme Information: MGYG000001546_02897

Basic Information

• Species: Alistipes provencensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes provencensis
• CAZyme ID: MGYG000001546_02897
• CAZy Family: GH88
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000001546_5|CGC46	45025.7	5.4018

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001546	3805103	Isolate	not provided	not provided

• Gene Location: Start: 3691885; End: 3693081 Strand: -

Full Sequence      

MRRNFLPVLGLLSLFVLGSCSAERDPKIASLKHAIGVADSQLLDAAAQLDTTNCFPRSLM
PKFRAVNAKDWTSGFFPGSLWQCYRFTGDEKLLAEAKKYTDRLEGIQYYKGTHDLGFMVF
CSFGQQMETLHDRHSEEVIVEAAKSLISRCDPRIGVIRSWDFGEWNYPVIIDNMMNLEML
FWASKHTGDPVYRDVAVRHADITMKNHYRDDASSYHVVSYNDDGTVESQGTFQGYSDSSA
WARGQAWGLYGYTMCYRETGDTKYLKHAERIADFIMHHPNTPADRIPYWDYNAPDIPDAP
RDASAAAVVSSALFELSTMVPEAEGKKYFDYAETLLMNLSSDAYLAEKGTNGGFILMHSV
GHLPADSEIDTPLNYADYYYLEAIGRYLSLRGLDPRRI

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	66	387	2.4e-126	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.23e-15	55	258	13	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam16386	DUF4995	0.001	1	59	1	58	Domain of unknown function. This family around 100 residues locates in the N-terminal of some uncharacterized proteins and glucuronyl hydrolases in various Bacteroides species. The function of this family remains unknown.
COG1331	YyaL	0.002	129	278	367	503	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04434	LanC_like	0.003	82	276	13	191	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62837.1	1.09e-292	1	398	1	398
QRM98745.1	2.83e-161	1	391	1	394
QUR44697.1	2.83e-161	1	391	1	394
CBK69606.1	2.83e-161	1	391	1	394
QUT32644.1	2.83e-161	1	391	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	8.70e-132	43	398	43	399	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	9.64e-55	70	386	41	363	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	5.24e-54	70	386	41	363	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	2.07e-49	63	387	60	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.12e-49	63	387	61	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	9.92e-112	53	390	56	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	5.28e-54	70	386	41	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8E372	1.16e-48	63	387	61	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	1.19e-48	62	387	61	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	5.93e-48	70	387	66	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000259	0.228070	0.771413	0.000092	0.000095	0.000080

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001546_02897.