CAZyme Information: MGYG000001548_01539

Basic Information

• Species: Paenibacillus_A tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A tuaregi
• CAZyme ID: MGYG000001548_01539
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	MGYG000001548_4|CGC27	83521.58	4.7201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001548	5663842	Isolate	not provided	not provided

• Gene Location: Start: 1673341; End: 1675641 Strand: +

Full Sequence      

MLTYKDKTKSVEERVEHLLKLMTTEEKVGQLVQPFGWLTYENREGTVTLSDSFKEQVAQG
GVGSLYGVLRADPWTGVTLENGLSAREGAEAVNLIQRYAVEQSRLGIPILIGEECSHGHM
AIDGTVFPVPLLLGSTWNVPLYREMCRAVAKETRAQGGAVTYSPVLDVVRDPRWGRTEEC
FGEDPYLIGEFAAAAVEGLQGEGLDSQNSVAATLKHFAGYGSPEGGRNAGPAQMGWRELL
EKDLYPFQRAVEAGAASIMPAYNEIDGIPCTVHTGLLDGVLRKMWGFDGMVITDCGAINM
LADGHDTAEDGPDAAIQAIRAGIDMEMSGEMFGKYLVDAVNDGQLEMDVLDQAVRRVLAL
KFRLGLFEQPYADPKRAEEVIGHPEHIRLARQLAAEGAVLLKNEGVLPLSKAAGRVAVIG
PNADQGYNQLGDYTSPQPKSKVATLLRGILGKFPDDEERVLYAPGCRIRGGSKEGFEQAL
HCASQADIVVMAVGGSSARDFGEGTIDLRTGASTVSDESWSDMDCGEGIDRMTLTLSGVQ
LELMQEIHKLGKPVVVVYINGRPIAEPWVDEHADAILEAWYPGQEGGYAIADILFGDVNP
SGRLTVSIPKHVGQLPVYYNGKRSRGKRYLETDSSPRYPFGYGLSYTSFSYSNLRLSASE
ISEGDTVRAEVDVTNTGSREGAEVVQLYISDVVSSVTRPLKELKGFEKIELKPGETRTVV
FTIGSEHLQFIGLDMKPVVEPGMFRVHIGRNVMDTLYAEFRVRKEN

Enzyme Prediction     

No EC number prediction in MGYG000001548_01539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	327	4.9e-73	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	15	760	38	762	beta-glucosidase BglX.
COG1472	BglX	4.55e-101	22	434	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.72e-88	23	360	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	5.34e-84	104	730	78	750	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	8.94e-70	398	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB46750.1	0.0	2	764	1	764
QLG38613.1	0.0	1	764	1	781
AET57453.1	0.0	1	765	1	766
QOS80959.1	0.0	1	764	1	782
QYK63376.1	0.0	1	765	3	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.77e-168	15	766	14	755	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.11e-167	15	766	14	755	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.68e-162	15	751	13	739	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	7.60e-155	4	755	36	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	5.19e-147	100	761	65	728	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.58e-151	15	762	38	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	6.22e-151	15	749	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.51e-146	99	749	57	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.27e-131	4	764	29	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.08e-107	10	762	34	775	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000096	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001548_01539.