CAZyme Information: MGYG000001548_01963

Basic Information

• Species: Paenibacillus_A tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A tuaregi
• CAZyme ID: MGYG000001548_01963
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000001548_4|CGC32	56101.04	5.6495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001548	5663842	Isolate	not provided	not provided

• Gene Location: Start: 2092090; End: 2093631 Strand: +

Full Sequence      

MLKNVGKCVLVTVLAVCSFAGVGAAPRQAAAFTSSNADSAMNAFVNVFYDPGAKYFYTNS
DHQIHSEHAFGPDGGKYTDFWWEAQLWETVMDAYERTHNSTYRTMIDEIYTGFNQKYPNM
MANDFNDDLGWWALACMRAYELTGTEEYRNRASFLFDQIYSFYDNTYGGGIWWKRDGTSP
QKNMATNAPMVITAVKLKNATGNPAYLTKAQNIYGWIKSRLSSGSKLGDHVEGSGSGTAV
DWDFSYNYGTYMGAALSLYKETHNAAYLTDANNSANYVISKMTLSNTLMYEGENDGAGFK
MIFMRYLNQLRLETGNSSYLTFLQQNATQAYNHRRNSDQIIGSDWTGPTGSGYVQSLAAA
AGASVLQLVPADGYTGFIAGNGVYEAENALLTKNGGGGIFNESSTAGYSGRGYVAGWNTN
GTGITFNVNQNSDSTRTMTIRYAAGAGNASRYISVNGSVIAPNQVFNATNGWGDWQTLTL
NVNLKAGFNTIVIGYDSSKGNANYLNVDQIYGL

Enzyme Prediction     

No EC number prediction in MGYG000001548_01963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	37	352	3e-73	0.8966480446927374
CBM35	384	504	3e-23	0.9495798319327731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	5.23e-36	70	352	22	337	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.88e-29	80	360	45	343	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	3.67e-24	384	508	3	124	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	1.82e-22	383	507	2	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	4.03e-16	383	494	2	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE45499.1	9.73e-283	27	513	28	513
ASS66072.2	8.84e-277	7	513	6	505
AZN39362.1	4.24e-267	28	513	32	511
QQZ59760.1	6.58e-254	3	513	5	518
AIQ68918.1	7.23e-251	3	513	5	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BOK_A	1.10e-54	31	366	1	338	ChainA, Alpha-1,6-mannanase [Niallia circulans]
4D4A_A	2.66e-54	28	366	19	359	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]
5AGD_A	1.42e-53	28	366	19	359	ChainA, Alpha-1,6-mannanase [Niallia circulans],5AGD_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBM_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	1.74e-53	31	366	4	341	ChainA, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]
5M77_A	1.60e-52	18	366	24	372	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94286	8.63e-09	381	510	747	868	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
Q56F26	4.61e-08	367	510	894	1030	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000501	0.998221	0.000666	0.000218	0.000188	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001548_01963.