CAZyme Information: MGYG000001548_02605

Basic Information

• Species: Paenibacillus_A tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A tuaregi
• CAZyme ID: MGYG000001548_02605
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000001548_4|CGC43	45192.21	5.0289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001548	5663842	Isolate	not provided	not provided

• Gene Location: Start: 2764869; End: 2766101 Strand: -

Full Sequence      

MLKKGLCVIIMISLMIALIPVNQASAAPNWKLVWSDEFDGSTLNRSNWTPEIGTGNGGWG
NNELQYYTDRSQNLQVTGGNLVITARKEAYGGMNYTSARIKTQNLKTFTYGKIEARIKLP
SGQGLWPAFWMLGSNFDTVGWPYCGETDIMERVNNNPFVNGAVHWDAGGQADYGKESGNL
DFSQYHVYSVEWDSKYIRWFVDGQQFNEFYIENGTGNTEEFQRPFFLLLNLAVGGNWPGA
PNNSTPFPSQMLVDYVRVYQDNGQSSTISNGVYTLASKASGKVMDVTDVSMASGAKIQQW
TNYTASNQQFRIESTGDGYYKLTAVHSGKVLDVPNSSTAAGVQLQQWDDNGTNAQRWRIV
DAGGGYYKLVSKANGLVVDVSGSSTADGAAVQQWTDNGTDAQKWALTKIN

Enzyme Prediction     

EC	3.2.1.39	3.2.1.6	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	34	259	2.1e-90	0.9956521739130435
CBM13	258	352	5e-21	0.5106382978723404
CBM13	335	408	5.5e-21	0.3776595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.25e-103	34	259	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	1.41e-57	30	260	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	7.69e-39	23	272	34	278	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd00413	Glyco_hydrolase_16	7.77e-37	36	259	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
pfam14200	RicinB_lectin_2	4.32e-36	306	394	1	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC06195.1	1.22e-203	1	316	2	317
QOT13503.1	2.38e-203	1	316	1	316
AWP27975.1	1.37e-202	1	316	1	316
AYB44749.1	7.90e-202	1	316	1	316
AVV58787.1	1.59e-201	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	1.63e-95	29	260	2	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	9.94e-89	29	260	3	232	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	7.98e-88	29	260	3	232	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
2HYK_A	2.05e-68	32	260	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4DFS_A	2.90e-68	29	261	17	264	Structureof the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	2.33e-82	25	313	20	310	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P45798	2.46e-58	22	260	32	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	7.53e-46	20	261	415	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	1.13e-38	30	262	20	270	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q9ZG90	6.09e-31	26	260	52	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999044	0.000185	0.000184	0.000168	0.000159

TMHMM  Annotations     

start	end
5	27