CAZyme Information: MGYG000001548_02675

Basic Information

• Species: Paenibacillus_A tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A tuaregi
• CAZyme ID: MGYG000001548_02675
• CAZy Family: GT2
• CAZyme Description: D-alanine--poly(phosphoribitol) ligase subunit 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2226	MGYG000001548_4|CGC45	247385.07	4.9242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001548	5663842	Isolate	not provided	not provided

• Gene Location: Start: 2848009; End: 2854689 Strand: -

Full Sequence      

MNLTGGEDKLSNLQAEHDVSNDIAIISMVCRFPGVESVEQYWELLARGVDALQLEPTASD
DPGVEPLSRLSGSSPIRVNTALENTARFDASFFKVTAKEAEIMDPQHRLFLESAWEAVEK
AGYNALEYDGLMGLFAGVSSSTYLINHLLGARDKEEAVSDLQLMIGNDKDHMTSQVAYRL
NIRGPVVAVQTSCSTSLVATHLACESLLSGQCDMALAGGVTIKYPQVPGYVHQQGGLTSS
DGLLKAFDAEATGTVYSNGLGIVVLKRLEDALRDRDTIHAVIKGSAINSDGANRIGYAAP
GVDGQAAVISEALNIAQIPPQAISYIEAHGSGTPLGDDIELEALSRAFASVQETQFCAIG
SAKTNVGHVEMASGMAGLIKTVLALKHRQIPASLHFETPNPRLEEPGCPFYVNNMLSDWD
AGDYGRIAGVSSFGLGGINAHIVLAEAPKPQMLVEENDKADCELLVISAKTRQALSRICT
NLDRYLEDYPGANLKDLAYTLKTGRAVFDYRAAIVFRDKENLQQQLRTMNLDHAAKRGPA
SKEKVIFHFSSKPGLSMKAAADLYVHSPKFRQIIGDLSLVIREKYPFDLKAAIQSGHAVN
TALTEKLTSWGIQTALARLFIEWGIEPSGMSGEGVGYWVAQSLSGRYSISRVLEQLIQSG
EQDEDQPLQISPSSLEPGFVLEFGCLETNGSGKLADLSEDGPGWVQTQLAILWVAGICPD
WRSYYAHEPRSKLQLPTYPFERETYWIGPLSSSKDSTRSTGLSQQDVKDYKEYIKNVWES
SLGVEITHLGETFFELGGHSLLATQILFMLNKTLGTEITMQQFFDHPTVEELAVLVEHQV
KTGLGLYTDLPEVENKLAERYDPFPLTDVQKAYWIGRSADLDLGNVSTHMYFENDMPDLD
IAKFEMVINQMVERHEMLRAVMLPNGQQQILPIVPKYQVRSYDMRLASEEAKISHIGSLR
EEMSHQMIDCYNWPLFDIRATALPGGMVRLHISVDLLIADAWSLELLIRDISAAYLDPAT
DLRPLELSFRDYVLACEQIEHTDLFRRSEAYWLERLPDLPMGPQLELVKDPAQIEKPEFR
RRRHTLTQAHWQQLKKRAEGYGITPTVILLSAFAEIITTWSRKSHFSLNLTLFNRLPLHP
EVTEVIGDFTSLTLLEIDNRQLAPFIQRAIRHQQQLLRDMDHRYFSGVRVTRELLARSKE
PSKAIVPIIFTSILNQGDNSQEEVASALASAPAASQEERYSVSQTPQVWLDHQVMERGGE
LHLNWDAVEELFPQGMLDEMFAAYCLLLELLATSDEVWNLPLPLSDRAAAYLPHREQLSK
VDAYHGADSPSETAKRPSSLLSSYHDHVQTRPQAVAILTPERELTYAELNDYADYVAGKL
LGLGVKPGEPVAVVMTKGWEQVAAVIGILKAKAAYLPVDASLPSARIAELLRLGEVRAAV
VQPDTNQAEWPNLQTVPLTTGCVPEGAYGEIDNEAEARLAYIIYTSGSTGVPKGVMIDHR
GAVNTIEAMIHKFGIGRDDVMLSLSSLSFDLSVFDLFGMLSAGGAIVLPDKDRLRDPSHW
LELMAKTGVTVWNTVPALMNMLTEYCKDMDSAPLSPLRLVLLSGDWIPLGLPDAIQRLNE
RTKIISLGGATEASIWSIYYPVELVHPEWSSIPYGRSLRSQRVYVLNERMEECPVGVSGE
LWIGGMGVAMGYWKDEARTEERFIRHPLTGERLYRTGDKGRYAKDGNIEFLGRDDLQIKV
RGHRIELGEIEASLKAHPFVQDAVVVARGEGDRQRLSAYVKVDREQAYGVAGLEGEELIT
DSVERMVFKLSEPALRKDLGGSRYRLYSSDDPEQSIAPYLRRRSYRQFKSEPIQHESFGK
FVAHLAGRTFDGLPFPKFQYGSAGGLYPVQVYFYLKPNAVESLPCGLYYYDRREHQLVLM
EENPQMDHFIHSPANRPIFDASAFSIFLIGSMEAIAPMYGEKEGLGYAMMEAGIISQLLE
EKGPEHGIGLSQMGTLGFDMIRPLFRLRASDVYLHCLLGGGIEPSQMTLEGQVEEMNLYS
SSKGEHKVSKPDIGKAMTAYLKERLPAYMIPADVYELETFPLTPNGKVDRKAIAASAASE
PEAPETTPVPSDEQQLPGMLVIQSDIIDAWRQALDRNEISIHDNFFDLGGDSVSMVAVYR
ELQSKYGSRLTMVELFRYTTIKDLTEFLYQDADGEQGNERQEAEAERANSRRSAMQQFAG
KRGSSR

Enzyme Prediction     

No EC number prediction in MGYG000001548_02675.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd12114	A_NRPS_TlmIV_like	0.0	1352	1787	1	434	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the TLM biosynthetic gene cluster from Streptoalloteichus that consists of nine NRPS genes; the N-terminal module of TlmVI (NRPS-5) and the starter module of BlmVI (NRPS-5) are comprised of the acyl CoA ligase (AL) and acyl carrier protein (ACP)-like domains, which are thought to be involved in the biosynthesis of the beta-aminoalaninamide moiety.
cd19535	Cyc_NRPS	0.0	863	1295	1	423	Cyc (heterocyclization) domain of nonribosomal peptide synthetases (NRPSs); belongs to the Condensation-domain family. Cyc (heterocyclization) domains catalyze two separate reactions in the creation of heterocyclized peptide products in nonribosomal peptide synthesis: amide bond formation followed by intramolecular cyclodehydration between a Cys, Ser, or Thr side chain and a carbonyl carbon on the peptide backbone to form a thiazoline, oxazoline, or methyloxazoline ring. Cyc-domains are homologous to standard NRPS Condensation (C) domains. C-domains typically have a conserved HHxxxD motif at the active site; Cyc-domains have an alternative, conserved DxxxxD active site motif, mutation of the aspartate residues in this motif can abolish or diminish condensation activity. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains such as the LCL-type which catalyzes peptide bond formation between two L-amino acids, the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and Cyc-domains. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain.
cd00833	PKS	6.65e-172	21	444	1	421	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.
COG3321	PksD	6.26e-168	23	655	6	643	Acyl transferase domain in polyketide synthase (PKS) enzymes [Secondary metabolites biosynthesis, transport and catabolism].
COG1020	EntF	2.80e-150	1086	1758	1	642	Non-ribosomal peptide synthetase component F [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAY90071.1	1.64e-228	22	1787	1212	3154
BAZ00088.1	4.83e-227	22	1787	1213	3163
BAZ75991.1	4.83e-227	22	1787	1213	3163
BAY30132.1	1.82e-225	15	1787	1208	3165
AFY93865.1	6.47e-137	20	840	958	1981

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LY7_A	1.56e-189	858	1785	5	890	ChainA, BmdB, Bacillamide NRPS [Thermoactinomyces vulgaris]
7LY4_E	1.61e-189	858	1785	5	890	ChainE, BmdB, bacillamide NRPS [Thermoactinomyces vulgaris]
7EMY_A	2.62e-173	844	2188	74	1421	ChainA, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EMY_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN1_A Chain A, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN1_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN2_A Chain A, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1],7EN2_B Chain B, Dihydroaeruginoic acid synthetase [Pseudomonas aeruginosa PAO1]
6LTA_A	2.71e-163	845	1780	38	955	ChainA, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTB_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTC_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_B Chain B, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23]
4WKY_A	8.06e-142	21	559	7	542	Streptomcyesalbus JA3453 oxazolomycin ketosynthase domain OzmN KS2 [Streptomyces albus],4WKY_B Streptomcyes albus JA3453 oxazolomycin ketosynthase domain OzmN KS2 [Streptomyces albus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O68006	3.36e-191	771	1766	545	1499	Bacitracin synthase 1 OS=Bacillus licheniformis OX=1402 GN=bacA PE=3 SV=1
Q9HWG4	4.58e-188	864	2168	69	1458	Pyochelin synthase PchF OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pchF PE=2 SV=1
A0A0H2ZGJ4	1.62e-187	864	2168	69	1458	Pyochelin synthase PchF OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=pchF PE=1 SV=1
P48633	4.68e-180	753	2188	7	1474	High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=irp2 PE=3 SV=1
G3XCV2	9.93e-173	844	2188	74	1421	Pyochelin synthase PchE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pchE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001548_02675.