CAZyme Information: MGYG000001549_00566

Basic Information

• Species: Gracilibacillus phocaeensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus phocaeensis
• CAZyme ID: MGYG000001549_00566
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	MGYG000001549_9|CGC6	98132.57	4.4795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001549	4547476	Isolate	not provided	not provided

• Gene Location: Start: 130696; End: 133230 Strand: +

Full Sequence      

MTNLTTWQLDNWKFKEATAEEWYTATVPGCVHTDLLDLGMIEDPFEGKKELDVQWVDKRD
WEYQTTFEVTEEALKQEYVVLTFHGLDTYADVRLNGHSILKANNMFRIWKVDIKDYLQLG
ENTLHIYFHSAVQYDLDKPDQLGYNLPADNDHSEDGGVGEKKLSVFARKAPYHYGWDWGP
RFVTAGIWKDVTIEAWSDVKVQDVYLEQQHITEEKAEVLAHVEVETTEAQQVTIKITDQY
GWEHTQQATLEAGQQVIDVPFTKESPRLWWSNGLGAAHLYQFHVEVVSSTDQVLSDYQLT
TGLRSIKLVRKADEAGESFYFELNGIPVFAKGANHIPNDSFETRISKEDYRHEILTAVDS
NMNMLRIWGGGIYEYEAFYEYCDQYGILVWQDFMFACSMYPGDEAFLANVKQEAMDQVKR
LRNYACIALWCGNNEMDSAWTEYIEEAGWGWKQRYNEEQRQAIWQDYEQVFHQILPEVID
QNDPVKDYWPSSPMQDLSGTSSQHATFDSVTRGDMHYWDVWHGQQPLEAYKQNVGRFMSE
YGFQSFPEERTVRTYAQEQEMALESDVMLHHQKNGAGNRLIKTYMDSYYQEPKDFSSFLH
VSHILQAEAIKQAVEGHRLHMPYCMGTLYWQMNDCWPVASWSSMDYYGRWKALQFTMKDR
FKPTVIIADQKEEQFTIYAVSDVIKQQEATLIYSLYDFNGSLLDQQHQQVTIEANTSSKL
IEEDVANIASGDRSQTLLRCELLIGDTVVDSIDHLFEKTKHLNLQNPHIKWELADDGFVL
TATSYATNVWLQAEETGFFEDNNFNLVPGIKKFVRYCQSLDPEVTDTVPVKQLQVTSMYD
YITK

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	724	1.6e-104	0.6835106382978723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.52e-101	10	795	17	765	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.46e-14	63	389	113	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	3.94e-14	673	761	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.57e-10	766	840	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	5.78e-08	199	304	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH36622.1	0.0	1	842	1	844
QOS78558.1	0.0	1	842	1	846
QLG41186.1	0.0	1	842	1	847
BAM48364.1	0.0	9	842	8	837
ANF97480.1	0.0	9	842	13	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.02e-207	12	814	15	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.09e-207	12	814	17	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.12e-207	12	814	17	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.97e-207	12	814	15	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.29e-205	12	814	15	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	6.89e-114	12	769	13	742	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	1.40e-112	10	814	11	824	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	4.00e-112	12	809	13	821	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	7.80e-112	12	809	13	821	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	1.58e-110	12	809	13	821	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001549_00566.