CAZyme Information: MGYG000001549_00986

Basic Information

• Species: Gracilibacillus phocaeensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus phocaeensis
• CAZyme ID: MGYG000001549_00986
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		47136.21	8.9733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001549	4547476	Isolate	not provided	not provided

• Gene Location: Start: 188321; End: 189553 Strand: -

Full Sequence      

MIILLIIMTFFWLMLMYYSAINIAGIWHRLKKKEAPELLHYPSVAIFIPAHNEEVVIADT
LRAMARLQYPGKLDIYLLNDNSSDRTGAIADEFARAFSSIHHIPVPMGEPKGKSRVLNYG
LKISQSDYFAVYDADNEPEPDALKKLVEAAENNEKAAGAVGYVKTKNMAKNALTRMIGLE
FQVFQLLMQCGRWALFRLGSLAGTNMLVKRQVVQELGEYDVRALAEDAELTVRITAMGYH
LPVVPASRTWEQEPEKIKTFVRQRTRWLTGNLYLLEKSIHDLSHWKGRTFALSLQHVFTY
LFFAVLLLVSDIFFIMGLLGFTLPDMRAPILILWFMSYIVYTSQLLSALVVDDNVSVKNV
CFILLMYFTYAQLFIILLFRSSLSYIWNRLRGQTITWDKTERFKGREESL

Enzyme Prediction     

No EC number prediction in MGYG000001549_00986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	42	269	8.2e-37	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.85e-58	46	227	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	4.72e-52	1	388	15	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06427	CESA_like_2	1.28e-40	42	270	1	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
cd06421	CESA_CelA_like	3.70e-33	42	275	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13641	Glyco_tranf_2_3	1.64e-29	42	270	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK89171.1	7.87e-214	6	408	7	409
AUD15016.1	3.67e-209	3	405	4	406
ALS76551.1	7.55e-207	11	409	12	410
ANU17779.1	3.07e-206	11	409	12	410
ALS77896.1	3.31e-205	3	405	4	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.81e-09	41	351	272	566	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5MLZ_A	1.14e-06	37	164	16	142	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.37e-82	8	403	10	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	5.55e-20	33	270	92	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q3MB01	2.32e-19	42	270	106	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8GLC5	8.02e-18	44	270	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	1.96e-17	44	270	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990352	0.009509	0.000070	0.000022	0.000016	0.000056

TMHMM  Annotations     

start	end
4	26
297	319
329	351
360	379