CAZyme Information: MGYG000001549_01719

Basic Information

• Species: Gracilibacillus phocaeensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus phocaeensis
• CAZyme ID: MGYG000001549_01719
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000001549_11|CGC3	83644.5	5.0673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001549	4547476	Isolate	not provided	not provided

• Gene Location: Start: 215345; End: 217603 Strand: +

Full Sequence      

MIEQQVDQLLSLMTLKEKVGQLNQKLYGWQVYKKEGDKYELTDIFKKHVEEFQGIGALYG
LFRADPWSGIHFDNGIPLEDCKYVTNMIQRYLKKHTRLGIPVLFSEECPHGHQGLNSIVF
PTHIGSGASWNPKLQQRVSNYVAKELQEKGVHLGLVSTLDIARDPRWGRTEECFSEDPYL
SSKMTEAVVKGMQGDSKKAPKVLAVLKHFAAQGSATGGHNAGPALIGERELREIHIPPMK
AGIEAGALACMAAYNEIDGVPCHSNPYLLTNLLRDELGFQGFVMADGVALERLLQLTGNI
GLAAKYALEAGVDLSLWDDIYTNIECAVKDGQIAEETVDKAVRRILYVKFLLGLFSADYQ
EDTTSIVNREEGRKLSVEIARESITLLKNKQNLLPLAKDKRTIAVIGPNADHVYNMLGDY
TPPQREDAVVTIKEGVSSIVNDHCKVLYTKGCDIRSEDKSDFEHAKAIASLSDVLILALG
GSSAREFGMSFHTNGAVINMDQSQMDSGENVDVENLRLGGAQEELVQELAELNIPMIGVL
VQGRPHSIKNIEPFLDAILIGWYPGQQGGKAIAEIIFGEINPSGKLPISIPYSSGQLPVY
YNYKDSGGKKDYYDGLGEAMYSFGYGLSYSSFDYQFDSKQELLIKREALNKGKVVELPIE
VTNDGPYDGYAVMQLYIKDIESSVTQRMLELKDFQKSWIRVNETKTITLTLTKEDLSVWN
LQMKQEVEAGKVLLMVGDFSRGFIEKELIINE

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	94	316	1.6e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.88e-150	6	737	38	751	beta-glucosidase BglX.
COG1472	BglX	8.63e-89	13	441	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.84e-74	97	738	78	770	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.94e-69	14	346	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	5.96e-58	384	629	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH37098.1	0.0	13	752	1	740
QNF27516.1	0.0	2	752	11	764
SQI53794.1	8.63e-293	2	752	10	763
QFK71465.1	1.56e-290	1	738	13	751
AIC93186.1	2.47e-282	2	752	10	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R5I_A	1.99e-112	3	737	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.07e-111	3	737	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.10e-111	3	737	5	720	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	2.39e-111	3	737	36	751	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5Z87_A	5.43e-111	9	750	50	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.34e-117	6	737	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.84e-114	6	737	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.18e-112	97	741	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.05e-109	2	740	36	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	6.42e-80	91	749	28	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001549_01719.