CAZyme Information: MGYG000001549_02101

Basic Information

• Species: Gracilibacillus phocaeensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus phocaeensis
• CAZyme ID: MGYG000001549_02101
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000001549_11|CGC14	47719.89	8.9328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001549	4547476	Isolate	not provided	not provided

• Gene Location: Start: 617417; End: 618616 Strand: +

Full Sequence      

MNKLKALIIRVRRSKLLLFVYKLAFLMISLFPKAKKTVIFESFHGKQYSDNPRAIYEYMK
EHYPSYQLYWSADKRYLSLFHSHGLPVLPRFSWQWLKIMPRAEYWVVNSRLPNWIPKSRK
TKYLQTWHGTPLKKLGLDLEDVHMPGTNLVQYKRNFKHEAMKWDYLISPNRYSSDIFSRA
FGFEGRMLETGYPRNDFIVNYQNDNKVIDQIKQKLAITPEKKVILYAPTWRDNQYFGRGR
YKYQAELDLHMLQQELGEDYVIILRMHYLVADHIDLTGLENFVVDASRYEDIRELYLISD
ILITDYSSVFFDYANLKRPIIFFVYDLEEYRDTLRGFYFDFEKDAPGPLVKTNQQMLDEI
KQLEHNDGQPSPTDLAFYQKFCYLEDGEASKKVIEEVFG

Enzyme Prediction     

No EC number prediction in MGYG000001549_02101.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	2.03e-142	32	399	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	6.70e-110	8	399	3	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTN00810.1	2.98e-139	13	398	359	738
AJI06556.1	4.07e-135	32	398	344	709
AIY76015.1	4.07e-135	32	398	344	709
ARO20908.1	4.07e-135	32	398	344	709
AJG93766.1	7.21e-134	32	398	345	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.54e-120	36	393	353	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.82e-119	36	393	353	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	7.89e-119	36	393	353	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	4.57e-172	13	398	359	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	3.00e-155	9	399	5	394	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	6.92e-138	35	398	27	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	1.13e-119	36	393	353	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ1	8.87e-34	26	395	19	378	Teichoic acid ribitol-phosphate primase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarK PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.841626	0.154091	0.002113	0.000479	0.000454	0.001244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001549_02101.