CAZyme Information: MGYG000001551_00285

Basic Information

• Species: Odoribacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter massiliensis
• CAZyme ID: MGYG000001551_00285
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000001551_11|CGC2	56307.02	6.4945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001551	4400991	Isolate	not provided	not provided

• Gene Location: Start: 63426; End: 64964 Strand: +

Full Sequence      

MIKFVFGLFLWCGLCGCNSSCPTISLRMDKQVAPVFIRQEENSVLHIQVDNTTDKELVLN
KLVLSAKGTSRIEAVKQVRIYFTGLNPNFSSTVLFGHTQDAREVNTFKGQQALKPGINHF
WVSVCLSENALLSDKIHFTCTDATLSDACVVVADSLPLLSSAVGYAVRLRGDDQVNAYRI
PGLVCTPKGTLIAVYDVRYNSAVDLQENIDVGVSRSVDGGQTWLPMQIAMDMGEWGGRSH
KENGIGDPAILVDPQTGRVWIAGLWLHGNPGKRAWWASKPGITPEETGQFVLAYSDDDGA
TWSEPINITSQVKKKEWYLCFQGPGMGITTQEGTLVFPAQFKDKNQVPYSTIIYSKDKGK
TWDIGTGARSNTTEAQVVELTDGSLMLNMRDDRGGSRAVMITKDFGKTWTEHVSSRSALP
EPVCQASLIRIHLKGGKPALAFFNPANTQGRVHSTLKISLDEGVTWPEKYHTLVYEPGSY
GYSCLTQIDSTTLGVLYEGAGELYFQRLNIGE

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	170	501	1.2e-98	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.29e-103	170	509	6	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam14873	BNR_assoc_N	5.46e-31	23	148	3	148	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
pfam13088	BNR_2	8.20e-26	208	487	15	272	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13859	BNR_3	8.80e-20	180	431	1	235	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.89e-15	174	498	271	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT68677.1	1.51e-166	25	512	185	674
QEC52569.1	5.04e-162	164	510	30	376
AEM69599.1	1.21e-161	20	512	22	528
ATA74786.1	1.81e-159	17	512	8	512
AEE51150.1	1.72e-158	34	508	41	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	8.30e-148	35	500	5	506	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
6MYV_A	5.38e-144	34	510	12	517	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	1.27e-143	34	510	33	538	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
6MNJ_A	2.24e-143	25	500	23	523	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
4Q6K_A	3.46e-139	34	500	15	509	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	2.44e-149	10	510	10	539	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	2.37e-40	171	510	388	823	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q02834	1.35e-35	169	510	58	398	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P10481	8.92e-33	178	508	36	372	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P15698	1.30e-32	170	508	44	390	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000116	0.039351	0.960515	0.000016	0.000026	0.000020

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001551_00285.