CAZyme Information: MGYG000001551_02030

Basic Information

• Species: Odoribacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter massiliensis
• CAZyme ID: MGYG000001551_02030
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000001551_11|CGC13	73535.03	4.9404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001551	4400991	Isolate	not provided	not provided

• Gene Location: Start: 2004560; End: 2006476 Strand: -

Full Sequence      

MKKFWWIGFVALAAFGCCRNEACKEEQALKYPNILDINYTPETIRGGAGWFTDQGAWMGF
TLPTAEKFTNGFCGPFDLDNRHWLSRSLVRPGFIDNGKVVSPEAFQADSMAYFPGQLYMQ
SSFSDIRIVQRLFFTDKNHALLVCESNRKIDWFFEGKLWDEDDTVEVRDKSLIIYLPRGE
VAAVTFQNDAELMQMSSVYKASFKQVADVRAAVFSFFNTKEEMEAGLPVAETILENIKAE
KAAHCSRWNNYLSSVLRTDMPAAYDRVAVKAMVTLLANWRSSKGDMLHDGMVPSHAVGYF
VGFWAWDTWKQAVATVHFEPELAKNQIRSMFDYQDEYGMIADCIYSDKRENNYRDSKPPL
AAWAVMEVFRHTGDTAFIREMYPQLLKYYRWWYQYRDHDRNGICEFGATDGTEEAAKWES
GMDNAVRFDEATMVRNAENAWSFNQESVDLNAYLGYEYELLQEMAGIIGESFEEPDYREK
IRTYFFDPQQGYFFDRVLNGDLVRVEGPEGWTPIWTGLASKEQVEAAMKIIADTSKFSTY
IPFPTLAADHPKFLPKGYWRGPIWLDQVYFGISGIRKYGYIKEADTYTDQVFTRLQGLTE
GAPIHENYGTHDGGLLKAPHFSWSSAHLLMLYWEYGKK

Enzyme Prediction     

No EC number prediction in MGYG000001551_02030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	213	635	1.6e-104	0.5263157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	8.57e-137	10	638	12	786	alpha-glucosidase; Provisional
COG3408	GDB1	1.65e-20	320	632	302	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	4.77e-11	356	586	178	450	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	8.80e-08	320	529	171	432	alpha,alpha-trehalase
COG1626	TreA	3.17e-04	356	632	222	552	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY39153.1	4.35e-253	30	637	36	644
ABR39053.1	4.35e-253	30	637	36	644
QUT89313.1	4.67e-252	17	637	21	642
ALK84236.1	5.01e-252	30	637	36	644
QEW38502.1	5.01e-252	30	637	36	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	9.14e-86	51	638	32	759	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.81e-85	51	638	32	759	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.70e-85	51	638	32	759	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.01e-80	51	638	33	760	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	2.58e-39	51	421	358	779	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	7.88e-85	51	638	55	782	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	2.80e-14	296	626	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	6.53e-14	296	626	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	6.69e-10	359	588	115	328	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000126	0.040196	0.959606	0.000028	0.000045	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001551_02030.