CAZyme Information: MGYG000001552_00392

Basic Information

• Species: Butyricimonas synergistica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas synergistica
• CAZyme ID: MGYG000001552_00392
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
991	MGYG000001552_7|CGC1	110573.79	7.7073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001552	4964733	Isolate	not provided	not provided

• Gene Location: Start: 106009; End: 108984 Strand: +

Full Sequence      

MYRLILFFAIFCLLSCPMTGRAQSQWVDSTLNTMSLEEKIGQLIMVAAYSNKDSLYEKQL
GETLEKYHIGGIIFFQGSPEKQALMTNDYQQQAIIPLMIGMDAESGVGWRIKPAMEFPNQ
TLLGAIRDTNLIYRIGQAIGRQCHTMGIHVNFAPVADINVNPKNPVIGIRSFGEKKDEVG
NRSLQYTRGLESQQIMAVAKHFPGHGDTDTDSHFALPLIRHSVARIDTVELYPFRQLIAA
GIPGMMVAHLNVPSYDSTNIPASLSRHIVTDLLRGKMHFDGLCFTDAMNMKGVTKGNSPG
EADVKALVAGNDILLFPENVEATVKKVKAAIHKGILTEEEIDEKCRRVLAAKEKYVLPNT
GAIDTVMLTSRLNTPADQALLQETYAEAITLIQNKDLLLPLTNLDTLRIASLNFGDRKAK
AFEGMLEKYAPCAHFSIQAGANKDAIEELLKDLSDYNCVIVYNSAARNTISRQFGSSQVL
SGILKQLKGKRVIFCHPATPYGLDIYSYLPLDAILLSYSHDTPAQEFAAQAIFGGIHVNG
KLPVSINYYFPVGTGLSTPKVRLGYHKPESSGMQSEILYRIDSVCQEAIRAKATPGCQVL
VAKDGYVVYNKAFGFNTYDKKKANTTDNIYDIASITKIAATLPAVMMLYDQQVIALDTPI
SRYSYAISQSNKKDLTIRELLLHNAGLKASFSFFSHAIDWEKMQGRLFTSKYTKTNTKKL
RERLYVNPSFKYRDSTFSFKGGKDYLLVSPHFYIHRHFQDSIHTLLLNTDLLPQKKYTYS
DLGFVLLKDIVEEQTITPFDVYNRDHFLKRLGAYNSGFNAHLHLDMDRVIPSSDDNVFRK
SVLKGYVHDPIAALMGGVSGNAGLFSTAEDLAKIMSVYLNHGQYGGEQIIDSATIDLFTC
TQLPPEQNRRGLGFDKPETLPDKTGPTCEGTPCTSYGHTGFTGAIAWNDPENQLIYIFLS
NRTYPNEFNDKLMKDNIRTKIQEIIYEAIVK

Enzyme Prediction     

No EC number prediction in MGYG000001552_00392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	315	5.4e-57	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	5.11e-88	35	349	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.65e-87	34	402	1	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK03642	PRK03642	6.59e-43	566	989	28	431	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	2.07e-40	581	972	1	318	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	5.65e-37	550	966	9	367	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO49790.1	0.0	1	991	1	991
AZS31299.1	0.0	1	989	1	989
SNV44480.1	0.0	22	989	26	993
ADY34197.1	0.0	22	989	26	993
BAX80990.1	2.18e-279	24	991	43	1014

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	8.32e-67	28	400	36	446	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.36e-66	28	400	10	420	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.48e-66	28	400	40	450	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	9.45e-66	34	395	11	379	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3SQL_A	1.60e-61	31	356	12	350	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.55e-66	28	400	36	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.89e-55	59	548	54	598	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	3.41e-49	26	402	18	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
Q2Y863	1.62e-32	69	322	28	288	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1
B5BB26	1.28e-28	568	972	30	405	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000785	0.726441	0.271992	0.000293	0.000243	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001552_00392.