CAZyme Information: MGYG000001552_03051

Basic Information

• Species: Butyricimonas synergistica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas synergistica
• CAZyme ID: MGYG000001552_03051
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000001552_10|CGC7	53349.34	6.5786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001552	4964733	Isolate	not provided	not provided

• Gene Location: Start: 917797; End: 919194 Strand: +

Full Sequence      

MKRWLIVLFLGMISIQLVYAQGKSLHQLQQEFVDLRFGMFIHFNMPTYFNEDWPDPDASP
ALFNPTKLDCKQWAKAAKSANMTYGCLTTKHHSGFCIWDTKTTDYSVMSSPFKRDVVKEY
ADAFRAEGLKVMLYYSILDMHARLRPHCITPKHVEMIKEQIRELLTNYGEISALIIDGWD
APWSRISYDEIPFEDIYRLVKSLQPDCLVMDLNAAKYPAEALFYTDIKSYEQGAGQHISK
ESNRLPALSCLPLQANWFWKESFPSTAVKNPESMVNENIIPMGKVYCNFILNVAPNREGL
MDANALKALKEIGKLWKNDGQVAILPETEAPIISSNIAKFKPAEGGWSSDYAIMDFANDD
NFGTCWNSNPEVKTPWLTVVLGREQPFNMVVITERNNDCMQEYRIEYRVNGVWKTIYEGK
VLASSRVKIHRFDTVWGDAVRITALKFNGTLSIAEFGVYCERCRF

Enzyme Prediction     

No EC number prediction in MGYG000001552_03051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	23	320	2.9e-73	0.8815028901734104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.33e-46	26	314	17	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	6.65e-45	26	316	16	327	Alpha-L-fucosidase.
COG3669	AfuC	4.66e-30	27	459	13	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	1.45e-14	342	454	7	122	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69664.1	5.13e-304	1	462	1	462
QUT41826.1	2.97e-303	1	462	1	462
ALJ40132.1	8.49e-303	1	462	1	462
QQA10757.1	8.49e-303	1	462	1	462
QMW89201.1	8.49e-303	1	462	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	2.75e-41	36	320	38	348	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
5K9H_A	6.09e-38	29	459	43	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	1.89e-34	40	459	25	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	1.24e-28	40	311	47	347	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	3.52e-28	40	394	34	410	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	4.05e-38	24	461	41	478	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.33e-34	39	462	52	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9VTJ4	3.91e-10	62	182	111	234	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P10901	3.34e-08	5	313	3	350	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q2KIM0	4.26e-07	32	321	56	370	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999194	0.000147	0.000158	0.000141	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001552_03051.