CAZyme Information: MGYG000001553_00211

Basic Information

• Species: Clostridium_P mediterraneense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P mediterraneense
• CAZyme ID: MGYG000001553_00211
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	MGYG000001553_3|CGC2	47888.21	9.7715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001553	3045114	Isolate	not provided	not provided

• Gene Location: Start: 93835; End: 95079 Strand: +

Full Sequence      

MQGLYQIAQLYIFLLFGVSVILATGGLIYSIRMKRNKQEPLKDEDCPVISVLVPAHNEEK
VIYNTVKALLQFNYPKDKFEVIVINDNSSDNTKEELERAKKDCNANNLIIINTDKITGGK
GKSNALNLAYARAKGEYIAVYDADNTAEPDALRYLATKAMSNKKYGAVIGKFRTRNRNSN
LLTRFINLETLSYQWVAQAGRWQTFGLCSIPGTNFIVKKEVVEKIGGWDPKAICEDTEIS
FRIYHLGYKIAFMPKAVTWQQEPETLKVWFKQRTRWCKGNMYVMAKFIKNIFKYKPSIVL
FDIFYFSSIYFLFLLSLVISDSVFILSLFKIIKINALAHSTLIWILLYVSFIIQIYVPVF
REKGEFGLLNIILVPISYFTYCQLWVLVSIKSFVEFVIDIVGKREVKWYKTERF

Enzyme Prediction     

No EC number prediction in MGYG000001553_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	277	1.8e-39	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	6.61e-65	51	236	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.67e-63	5	408	9	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	7.50e-55	1	357	3	359	N-glycosyltransferase; Provisional
cd06427	CESA_like_2	1.10e-47	47	290	1	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
cd06421	CESA_CelA_like	5.24e-41	47	281	1	231	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ50399.1	2.86e-167	4	414	12	420
AVQ47001.1	2.86e-167	4	414	12	420
AVQ52631.1	5.76e-167	4	414	12	420
AVQ38745.1	5.76e-167	4	414	12	420
APH15042.1	5.76e-167	4	414	12	420

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.84e-14	47	283	273	504	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6P61_A	3.91e-13	47	184	13	142	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5EJ1_A	4.17e-12	10	290	87	383	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.36e-12	10	290	99	395	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.36e-12	10	290	100	396	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.13e-117	22	414	23	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q6GDD8	8.70e-33	9	286	2	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q5HCN1	8.70e-33	9	286	2	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q9RQP9	8.70e-33	9	286	2	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	8.70e-33	9	286	2	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
298	320
340	359
366	388