CAZyme Information: MGYG000001553_00434

Basic Information

• Species: Clostridium_P mediterraneense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P mediterraneense
• CAZyme ID: MGYG000001553_00434
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		30763.28	6.0339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001553	3045114	Isolate	not provided	not provided

• Gene Location: Start: 168274; End: 169080 Strand: -

Full Sequence      

MTKVLIGSPIHQNPNILKEFLTSLKGLEKDDLTVEYYFIDDNKDEESKAVLKAFKDEVKG
TRIIDSTYDSQYICTQVTHIWSNDLVSKVANFKNSIIEVARKENFDYLFFIDSDIVLHPK
TLKRLISTNKEIVANIFWTRWVPGASELPQVWMKDVYTLYDSEPGVVLNQEQINQKTDEF
LKMLRTAGTYKVGGLGACTLISKSALEKPISFDPIYNVSFWGEDRHFCIRAIVLGIDLYV
DTFYPAYHIYRLTDLGGINNFKKSCLGQ

Enzyme Prediction     

No EC number prediction in MGYG000001553_00434.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	8.08e-06	1	250	2	218	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.10e-05	9	126	5	100	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	1.33e-04	13	235	66	251	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	2.30e-04	33	237	31	200	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	0.002	4	142	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW43447.1	4.72e-121	1	263	1	263
AVQ51251.1	1.95e-98	3	263	82	343
AVQ47703.1	1.95e-98	3	263	82	343
QGQ96507.1	3.60e-98	3	265	2	264
BAH07189.1	3.37e-97	2	266	6	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q17FB8	2.24e-07	3	134	30	166	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001553_00434.