CAZyme Information: MGYG000001553_02455

Basic Information

• Species: Clostridium_P mediterraneense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P mediterraneense
• CAZyme ID: MGYG000001553_02455
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915	MGYG000001553_5|CGC18	102049.5	8.4078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001553	3045114	Isolate	not provided	not provided

• Gene Location: Start: 2187920; End: 2190667 Strand: -

Full Sequence      

MKRYNKAISLILSIILFAIMIPGKMVQADNNLNIISETIITKEDAKRWARGKNATNTFIE
LADLYWEYYDKHGYVNPAIAYIQSGIETGFGNFGGVIDETYFNPCGMKNPVGGEDIDPNA
HYKFNNWHEGVKAHLDHLALYAGADSYPRTNNTYDPRHFNYLYGSAKNVSSLSGKWANDS
EYGDKIIRNYNEMRALSKKPSKMWIESPSNGTVIDNTFKIVGWGINDSGVQKVNVYVDGK
YFSELRSGIIRYDVDSAYPGYLDGYKSGFEGIIDLSNHSSGQHHIKVEVVGKDGTSQSQE
FNIERKKKKSLMWIEKPSNNSTFTKEIEISGWALDDSGISEIKAYVDNKYVGTLTSGIVR
EDVDNVYPGYVGGKNSGFSGKISLDKYSSGNHVIRIDAIGKDKSINSQYVNIIRNKKQSM
TWIDYPTDGQSFEHTFKIVGWGINDSGVKAVKAYIDGKYIKDLGIGLIREDVNNLYPGYT
TGKNSGFEGEINLRNYSDGQYTLRVDVIGNDNSIDTAYKVINKKNKEAKMWIESPANGQS
VNELLNISGWAINNSGVKEIKAYIDNRYIKNLTTGLIREDVNNAYPGYINGNKSGFEGYL
DLSNYSSGMHNITVKVVGNDNSIQSQVISINLVKKQSKVWIDKPLNGYNTNKDNIQLEGW
ALNSSGVKDINVYINDSFIGKATKGIARPDVNNAYPGYKDGYNSGFKMNIDLTKQSRGNK
IIKVEVVGNDGSKNYISTSIYLDKVNIIDLGLEFDFGVEGPLPNVPDKLVLHHAAGNATA
ASVHNFHRFTNGWAGIGYHFYIHKDGKIYKGREENWRGAHAAEVGPSDGNLDNDTNATSL
GIAVMGDYYKETMPKAQEDAVVELGKYLVSKYGMKQIFRHGDPGIGQTLCPGKNYPFERI
KARILNKQIFVYKQD

Enzyme Prediction     

No EC number prediction in MGYG000001553_02455.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	1.74e-26	766	892	2	124	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	2.44e-25	766	893	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00701	PGRP	2.66e-16	759	879	21	135	Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.
smart00644	Ami_2	7.55e-12	765	891	2	126	Ami_2 domain.
PHA00447	PHA00447	6.43e-10	767	892	11	131	lysozyme

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE34895.1	4.01e-163	27	744	34	778
QAS60290.1	5.95e-162	27	744	34	778
QLY79091.1	4.96e-127	195	744	38	586
AGK97878.1	1.05e-109	200	741	38	591
ADL53568.1	1.91e-93	184	740	122	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SRT_A	5.69e-27	766	904	41	166	EndolysineN-acetylmuramoyl-L-alanine amidase LysCS from Clostridium intestinale URNW [Clostridium intestinale URNW]
6SSC_A	1.07e-26	766	904	64	189	N-acetylmuramoyl-L-alanineamidase LysC from Clostridium intestinale URNW [Clostridium intestinale]
7F5I_A	2.22e-17	764	900	29	152	ChainA, amidase [Clostridium perfringens str. 13]
4Z8I_A	6.59e-11	768	902	89	221	Crystalstructure of Branchiostoma belcheri tsingtauense peptidoglycan recognition protein 3 [Branchiostoma belcheri tsingtauense]
4ZXM_A	8.73e-11	768	902	118	250	Crystalstructure of PGRP domain from Branchiostoma belcheri tsingtauense peptidoglycan recognition protein 3 [Branchiostoma belcheri tsingtauense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9V4X2	1.26e-11	762	894	40	171	Peptidoglycan-recognition protein SC2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SC2 PE=2 SV=1
Q70PU1	3.15e-11	770	894	48	171	Peptidoglycan-recognition protein SC2 OS=Drosophila simulans OX=7240 GN=PGRP-SC2 PE=3 SV=1
C0HK99	5.93e-11	762	892	41	170	Peptidoglycan-recognition protein SC1b OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1b PE=1 SV=1
C0HK98	5.93e-11	762	892	41	170	Peptidoglycan-recognition protein SC1a OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1a PE=3 SV=1
Q70PU2	6.80e-10	762	892	41	170	Peptidoglycan-recognition protein SC1a/b OS=Drosophila simulans OX=7240 GN=PGRP-SC1a PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.999025	0.000186	0.000171	0.000158	0.000153

TMHMM  Annotations     

start	end
7	26