CAZyme Information: MGYG000001553_02536

Basic Information

• Species: Clostridium_P mediterraneense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P mediterraneense
• CAZyme ID: MGYG000001553_02536
• CAZy Family: GH73
• CAZyme Description: Beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214	MGYG000001553_5|CGC21	24040.91	4.8731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001553	3045114	Isolate	not provided	not provided

• Gene Location: Start: 2319488; End: 2320132 Strand: +

Full Sequence      

MFEFLRIDQFRAVHLNKLNELLEGCGVLTGQGQAFIDACQEYNIDPVYFVNQSILETGYG
TSRLASGVTISEIAIPSEPIYNSNGQLVGYQMKKLPHPVTVYNLFGIGAYDNSSVFPNRA
LILGTTYAYNHGWTSVPNAIAGAAQFVSNGYIHNSYYNQNTVYKLRYSPVINSLWHQYAT
NYAYANEIANLMEQNMDLYDSGDKFTYDVPVFQS

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	32	195	1.4e-27	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	3.52e-45	2	213	70	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
smart00047	LYZ2	2.93e-19	21	200	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	2.14e-07	27	208	38	196	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	3.24e-07	32	115	1	51	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK06347	PRK06347	1.53e-06	50	202	176	305	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA11114.1	4.20e-85	3	213	754	963
ABG85681.1	1.21e-84	3	213	759	968
AOY53990.1	1.30e-84	3	212	919	1127
SQG39099.1	1.30e-84	3	212	919	1127
AWS26021.1	2.11e-84	3	212	834	1042

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WQW_A	2.74e-93	3	212	61	269	X-raystructure of catalytic domain of autolysin from Clostridium perfringens [Clostridium perfringens str. 13]
6FXO_A	1.67e-34	2	213	62	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4PI7_A	1.21e-25	3	195	55	211	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
4PI8_A	9.21e-25	3	195	55	211	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6U0O_B	3.22e-17	2	192	101	256	ChainB, LYZ2 domain-containing protein [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39848	1.94e-35	2	213	704	880	Beta-N-acetylglucosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytD PE=1 SV=1
Q8CPQ1	4.55e-34	2	213	1153	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
O33635	1.15e-33	2	213	1153	1335	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q5HQB9	1.15e-33	2	213	1153	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q931U5	2.14e-31	2	213	1066	1248	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001553_02536.