CAZyme Information: MGYG000001554_01113

Basic Information

• Species: Corynebacterium phoceense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium phoceense
• CAZyme ID: MGYG000001554_01113
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	MGYG000001554_2|CGC2	59861.96	9.8948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001554	2774100	Isolate	not provided	not provided

• Gene Location: Start: 241606; End: 243210 Strand: -

Full Sequence      

MSTATVSKSSSHTRRSRLYGAHAVRDIPAPRRYPWTRADTYSTLVIAFLALVTRFAGLTA
PVSGGTPVFDEKHYVPQAYDMVRSWDNLLIGGIESNPAYGLVVHPPLAKQITALSEMVFG
YTPLGWRLMAALFGVGVVLLTMQLARVLSGSWKVATFAGLIAAFDGVLLVTAKFGMLDIF
QVFFVVLAAYLLARDHEQMRMRLHTAWATGGMGDSDFGPRFGFRWWRFAAGVALGLALAV
KWSGLYFIMFFGLLSVFTDLALRRRYGVRRYVVGTLVRDTPAALASLVLVPVLVYVWSWR
SWFASETSVYRHAKVDGTIPDDSFLQHFPEPVAGWFYYHQSVLEFHASLTSSSGHSHPWD
SKPWAWLVAARPILYYSNTDTTCLGGQDCKQMLFLFGTPIIWWLTIPVLLWGLWSLVIRH
DRRFLLPLVGFAAAFLPWLASFDRQMYFFYAATFIPFVIILLALTLGQIAGTGKPVKNGF
VHALGGDTLRWGTAGVLLYLCAVVAFFAVFSPLLYGFAIPNWYYNSIMWLPSWQ

Enzyme Prediction     

No EC number prediction in MGYG000001554_01113.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	46	303	5.9e-62	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	8.09e-52	35	534	35	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.62e-14	45	254	2	195	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam16192	PMT_4TMC	2.84e-14	335	531	3	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	1.33e-13	104	254	136	255	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	7.08e-08	70	254	34	191	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK79810.1	5.33e-297	21	534	13	522
APT92958.1	8.38e-288	14	534	21	545
VEH72496.1	4.60e-284	28	534	35	541
QRJ57270.1	3.84e-282	29	534	23	528
QRP20735.1	3.84e-282	29	534	23	528

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	2.87e-238	28	534	23	520	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
L8F4Z2	1.56e-132	27	534	24	516	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	7.64e-129	43	534	47	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.64e-129	43	534	47	522	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999483	0.000513	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
41	63
118	140
147	169
174	193
228	250
282	304
392	414
424	441
448	470
496	518