CAZyme Information: MGYG000001554_02294

Basic Information

• Species: Corynebacterium phoceense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium phoceense
• CAZyme ID: MGYG000001554_02294
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		43684.87	7.5805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001554	2774100	Isolate	not provided	not provided

• Gene Location: Start: 1460339; End: 1461526 Strand: +

Full Sequence      

MIVLAWLALAAALLFATVDAGALLRGEGLAWHHHIDLLVYQAGGHAALSGETYYDQVFAV
DGTQLPFTYPPFAALVFTPLAPLPWQLAALAWNAATLAALWWCIRLLVRDPRTALLLTAA
AAWTEPLTENLSFAQINVFLAALVLSDALFISVHPSPSVARWRGWLTGVAMAIKLTPAVF
LAYFFARRDWRGVAGGIGSFVACSVVGLLPRPENSVEYWTATLRDSERIGALAYAGNQSL
RGFVERLGLGEGWWLMGVAVLGVVLAVALFIRLREPAALVLVTSLAALLGSPVSWSHHFV
WCVLLAVFFTARQNWWLAVPTWIVLFARGHWLVPHAHDFEYGWSWWQMLPGNDYLAWGGV
LALCAALAPQFFERRQARRDHGPTQHRDLLHEPQR

Enzyme Prediction     

No EC number prediction in MGYG000001554_02294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	67	292	1.1e-64	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	1.06e-39	35	368	45	385	mannosyltransferase; Provisional
pfam09594	GT87	6.54e-31	67	292	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACP33282.1	2.16e-95	18	354	5	345
QQA98319.1	7.61e-94	18	365	24	371
QQN48578.1	1.08e-93	18	365	24	371
QQU96769.1	1.51e-93	18	354	8	348
QQU82094.1	1.52e-93	18	365	24	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	2.30e-44	33	367	43	404	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	2.30e-44	33	367	43	404	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	5.87e-42	33	367	45	413	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	4.67e-41	35	368	57	397	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	3.56e-38	11	368	43	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999183	0.000150	0.000155	0.000139	0.000137

TMHMM  Annotations     

start	end
2	24
82	104
131	153
163	185
192	209
252	271
278	300
354	372