CAZyme Information: MGYG000001555_01197

Basic Information

• Species: Fusobacterium massiliense
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium massiliense
• CAZyme ID: MGYG000001555_01197
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		59556.16	8.5108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001555	1808926	Isolate	not provided	not provided

• Gene Location: Start: 333283; End: 334785 Strand: +

Full Sequence      

MNREAGVLLAISSLPSPYGIGDLGEEAYRFVDFLKASGQKLWQILPLCPIEYGNSPYQSP
STFAWNFLYIDLEELVKEGYLNFEDINELKQEVAPVNYDVIKSRKEFLLKKASMAFFCKN
KEIKELQEFQEKNKFWLEDYSIFLYLNKIYRGKIWNQWDRKDKVRDTNRLLELKIEAKEE
YKYQSFIQYYFYKQWKKLKEYANENSIKIVGDLPIYVATHSSDTWKNPELFMFDKHLKIE
SVAGCPPDYFSKDGQLWGNVLYNWKEHEKTQYEWWTARIKHCSLLYDVLRLDHFRGFASY
WSVKYGDKTAAKGKWKIGPRYIFFKKIENKVKNIEFIAEDLGTLTPDVFKLLKQTQYANI
KVLQFGMAEWDNMYQPKNYPENCVAYTGTHDNMTIVEWYENLSKNEKFICDESLKDILEK
NGANIWEPIQWRALEVLYSSKANKVIIPLQDILGLGKDSRMNTPSTVGKNWEWRVYKNYR
HPDLENKLNFLVNKYNRNKD

Enzyme Prediction     

No EC number prediction in MGYG000001555_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	9	491	1.5e-153	0.9858299595141701

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	497	3	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	9	475	1	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	7.01e-166	1	497	12	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PLN02635	PLN02635	1.81e-154	3	497	28	525	disproportionating enzyme
TIGR00217	malQ	1.18e-121	3	497	14	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJX50669.1	2.13e-281	1	497	1	497
QQS86869.1	4.30e-281	1	497	1	497
QQB73346.1	6.10e-281	1	497	1	497
ALQ42330.1	7.09e-280	1	497	1	497
ALM93657.1	7.09e-280	1	497	1	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	6.44e-134	3	479	22	487	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	1.33e-119	3	491	5	487	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	1.29e-116	3	497	70	563	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	1.56e-113	3	475	26	498	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
2OWC_A	6.42e-113	3	475	8	479	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	4.23e-146	11	497	3	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O66937	1.32e-133	3	479	2	467	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P0A3Q1	4.10e-129	3	497	4	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	4.10e-129	3	497	4	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	3.42e-119	3	497	5	499	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.967243	0.032350	0.000195	0.000088	0.000042	0.000091

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001555_01197.