CAZyme Information: MGYG000001556_01094

Basic Information

• Species: Acidaminococcus massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus massiliensis
• CAZyme ID: MGYG000001556_01094
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000001556_4|CGC5	40979.86	7.7819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001556	2669282	Isolate	not provided	not provided

• Gene Location: Start: 1110856; End: 1111992 Strand: +

Full Sequence      

MTKVFISAGEASGDLHAAALTRAILQRDPTVQVFGMGGDALAAAGGEVVFNYKDYSVMGF
VEVLQSLPRLFGLKKAFRRLMEERKPDVFVTVDYPDFNMRVAKEAKALGIPVFSYIPPSA
WAWRRGRAKDVARLATKVACIYPFAAQVYQEAGANVEFVGNPLVDIVQPTLSPQEGEAFI
GKRPGHPVVLLLPGSRVKEITGVLPVMLQALPKIQEKRPEVDFVLQKAPSIERELLRSIL
ASSAVPVKVVEGRGYDVMAASDAALATSGTVTLEAALCGLPSVICYAASPLSMWIAKRMV
YVKYIGLPNILAGREILPELIQEKMTPDHMAASILHFLEPEAASAVREEMRQAVAKLGQP
GAVDRTAELILETAKENP

Enzyme Prediction     

No EC number prediction in MGYG000001556_01094.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	5.7e-123	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.05e-126	1	378	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.31e-108	1	376	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.00e-86	4	372	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	3.80e-50	1	328	1	307	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.50e-37	5	352	230	584	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48042.1	1.75e-240	1	378	1	378
AEQ21864.1	2.64e-186	3	376	2	375
BBG63223.1	3.59e-141	1	376	1	376
QNP77898.1	3.59e-141	1	376	1	376
QTV78315.1	2.29e-138	1	376	6	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.13e-58	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.98e-57	4	375	9	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.74e-97	3	372	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	1.85e-94	3	372	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.96e-93	3	372	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	4.05e-93	4	377	6	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B4UHR6	2.96e-87	3	371	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001556_01094.