CAZyme Information: MGYG000001556_01096

Basic Information

• Species: Acidaminococcus massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus massiliensis
• CAZyme ID: MGYG000001556_01096
• CAZy Family: GT30
• CAZyme Description: Tetraacyldisaccharide 4'-kinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	MGYG000001556_4|CGC5	94837.38	8.6693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001556	2669282	Isolate	not provided	not provided

• Gene Location: Start: 1113828; End: 1116359 Strand: +

Full Sequence      

MYYIYNFLATVLFILVILPYFTWRYFREKGFPRRFRQSMGFLRDEEIAAVAHKNCIWIHG
ASVGEIVATSPLVKEIRKAMPDAKILVSAVTTGGYNMAHQIIPEADAIIYFPLDLPFVSE
SFVKRIMPRIFMPVETELWPNFLRAIKLRRIPVMMVNGRISDKSVKSYRYLFGILTDMMG
SVTRFCMQSSIDAEYIQHLGAEKRRIFVTGNTKFDQTYAEVTPEDLQQYKEELGLGSDYP
VIVAGSTHPTEEETLFQSFLEIRKEFPKARLIIAPRKPGRVHEISRLAEKYGLSLGLRSV
LKDTSSPRPRYQVVLIDTIGELGRIYAVGDAVFVGGSLINHGGHNVLEPAAHAKPIIVGP
SMSNFKDSFALLSKVGACVQIHDGKEMTDMFLKIFRDDGLRKKMGDASLQVIRENRGAAV
RTIGYLKELLELTATESMVNTHYKINTRNINDEISPRMRPGDAVTQYLIQLSHGEDNGIL
DWCVLAFLRVLSVLYEAGVRLKLFCYNAGIMPRTKLDCCVISIGNITVGGTGKTPTAQKV
ALMIQKMGYRVVILNRGYRSHWEEKIGVVSDGKKIYMTAYEAGDEAFLMAKQLPGIPVVI
GKERAITGQFAVDKFQAEVIILDDGYQHWQLYRDLDVVLVDTLNMFGNGCILPRGTLREP
LSNLSRAGLFLLTKCDQSSPISRATLCDTLHKYAPAAPIAESIHKPCDYIEIADWYKNDM
TKALPLEALRGKHVMVFSAIGNPSSFEQTMTAEGLNIVEAIRYPDHHDYGMVEMQYIMDR
AISRGVKALVTTGKDAVKIPTEFIYLHRDVPLYILDMEIQITSGEKAFVDTIKAAIKKEK
PSK

Enzyme Prediction     

No EC number prediction in MGYG000001556_01096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	37	216	1.6e-54	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	6.98e-126	1	431	2	422	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	1.52e-110	5	430	5	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam02606	LpxK	7.97e-87	485	832	2	316	Tetraacyldisaccharide-1-P 4'-kinase. This family consists of tetraacyldisaccharide-1-P 4'-kinase also known as Lipid-A 4'-kinase or Lipid A biosynthesis protein LpxK, EC:2.7.1.130. This enzyme catalyzes the reaction: ATP + 2,3-bis(3-hydroxytetradecanoyl)-D -glucosaminyl-(beta-D-1,6)-2,3-bis(3-hydroxytetradecanoyl)-D-glu cosam inyl beta-phosphate <=> ADP + 2,3,2',3'-tetrakis(3-hydroxytetradecanoyl)-D- glucosaminyl-1,6-beta-D-glucosamine 1,4'-bisphosphate. This enzyme is involved in the synthesis of lipid A portion of the bacterial lipopolysaccharide layer (LPS). The family contains a P-loop motif at the N-terminus.
PRK00652	lpxK	5.11e-66	485	838	15	325	tetraacyldisaccharide 4'-kinase; Reviewed
pfam04413	Glycos_transf_N	1.17e-65	36	216	1	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB48040.1	0.0	1	843	1	843
AEQ21866.1	0.0	1	839	1	839
BBG63225.1	0.0	1	839	1	839
QNP77900.1	0.0	1	839	1	839
QTV78313.1	0.0	1	839	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EHX_A	1.35e-38	492	799	10	285	Crystalstructure of LpxK from Aquifex aeolicus at 1.9 angstrom resolution [Aquifex aeolicus VF5],4EHY_A Crystal structure of LpxK from Aquifex aeolicus in complex with ADP/Mg2+ at 2.2 angstrom resolution [Aquifex aeolicus VF5],4ITL_A Crystal structure of LpxK from Aquifex aeolicus in complex with AMP-PCP at 2.1 angstrom resolution [Aquifex aeolicus VF5],4ITM_A Crystal structure of 'apo' form LpxK from Aquifex aeolicus in complex with ATP at 2.2 angstrom resolution [Aquifex aeolicus VF5],4ITN_A Crystal structure of 'compact P-loop' LpxK from Aquifex aeolicus in complex with chloride at 2.2 angstrom resolution [Aquifex aeolicus VF5],4LKV_A Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_B Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_C Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5],4LKV_D Determinants of lipid substrate and membrane binding for the tetraacyldisaccharide-1-phosphate 4 -kinase LpxK [Aquifex aeolicus VF5]
4EHW_A	1.41e-38	492	799	12	287	Crystalstructure of LpxK from Aquifex aeolicus at 2.3 angstrom resolution [Aquifex aeolicus VF5]
2XCI_A	1.17e-30	53	387	37	336	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CZC3	1.16e-69	467	821	12	371	Tetraacyldisaccharide 4'-kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=lpxK PE=3 SV=1
Q2LVL1	1.62e-66	488	828	27	363	Tetraacyldisaccharide 4'-kinase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxK PE=3 SV=1
A5G6H1	7.71e-66	467	820	7	343	Tetraacyldisaccharide 4'-kinase OS=Geotalea uraniireducens (strain Rf4) OX=351605 GN=lpxK PE=3 SV=1
A1ATF5	7.13e-62	463	799	4	325	Tetraacyldisaccharide 4'-kinase OS=Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) OX=338966 GN=lpxK PE=3 SV=1
B8F928	1.20e-61	486	836	25	364	Tetraacyldisaccharide 4'-kinase OS=Desulfatibacillum aliphaticivorans OX=218208 GN=lpxK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26