CAZyme Information: MGYG000001556_02502

Basic Information

• Species: Acidaminococcus massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus massiliensis
• CAZyme ID: MGYG000001556_02502
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		29514.13	9.0719

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001556	2669282	Isolate	not provided	not provided

• Gene Location: Start: 2621431; End: 2622225 Strand: +

Full Sequence      

MRKLLCILVLLAGALCYYVTRPSTIHEKVGAPAERAVLQTLPRGVPQDSFVRDLPRPLQL
AWQGWHIREIARSRIPREDWVSLKDMSSWLPKAQVAVEDKRFYSHHGVDPDGIIRATLVN
IQNDEVVEGASTITQQLVKNLLLEADPSLRRKFTEAGLAFLVEARCSKQEILEMYLNTTF
LGAGATGVKQASQVYFGKKPKDLSLPQSATLAGLPYAPTALNPYNNWQGCKKRRNLVLNR
MAEQEMITPEQLEDALDSPLGIGK

Enzyme Prediction     

No EC number prediction in MGYG000001556_02502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	76	241	2.6e-63	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.68e-82	80	260	4	184	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.88e-82	72	264	70	263	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.91e-81	68	242	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	4.88e-73	54	261	45	250	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.30e-54	74	260	66	248	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB46989.1	5.38e-162	1	264	1	265
AEQ23280.1	1.07e-81	1	255	1	248
BBG64464.1	8.89e-59	1	260	1	268
QNP76977.1	8.89e-59	1	260	1	268
QTV77901.1	3.77e-57	26	255	41	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.21e-50	75	257	17	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.28e-49	75	257	17	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	9.08e-43	53	260	17	222	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	5.11e-33	77	255	26	204	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	7.36e-33	93	260	54	221	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	2.44e-47	75	264	60	249	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P31776	1.22e-43	53	260	32	237	Penicillin-binding protein 1A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcA PE=1 SV=2
O87579	2.66e-43	36	260	27	250	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q4UK08	3.53e-43	77	264	66	256	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1
Q92G78	4.84e-43	77	264	66	256	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.898631	0.088756	0.012183	0.000152	0.000095	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001556_02502.