CAZyme Information: MGYG000001558_00336

Basic Information

• Species: Streptococcus timonensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus timonensis
• CAZyme ID: MGYG000001558_00336
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001558_1|CGC5	39588.78	7.0337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001558	1925331	Isolate	not provided	not provided

• Gene Location: Start: 327281; End: 328339 Strand: +

Full Sequence      

MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKHGIEHQEILKSGLDVTFHSIAT
GKLRRYFSWQNMWDVFKVAWGIVQSFFIMLMIRPQALFSKGGFVSVPPVIAARLSRVPVF
IHESDLSMGLANKIAYKFATKMYSTFEQPASLTKVEHVGAVTKVSGPVIEEPEIMVDIRT
CFDSNLPTLLFVGGSAGARVFNQLVTDHKNELTSRYNIINLTGDSSLNELSKNLYRVDYV
TKLYQPLMNMADVVITRGGANTIFELLAMAKLHVIVPLGREASRGDQIENAAYFVKKGYA
EELQESDLNLSNLEEKVTLLLNNKEIYQNTMRDSHELKSVADFYELLKKDLS

Enzyme Prediction     

No EC number prediction in MGYG000001558_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	338	7.3e-32	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.72e-137	1	337	1	338	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	8.80e-111	2	352	1	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	2.33e-98	1	332	1	334	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	4.02e-80	3	333	1	333	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	6.98e-68	2	347	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF55861.1	8.52e-228	1	352	1	352
AMD97511.1	1.21e-227	1	352	1	352
BBP10138.1	4.80e-218	1	352	1	352
CBZ01068.1	3.93e-217	1	352	1	352
VEF78594.1	7.93e-217	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.08e-21	3	337	4	338	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.08e-21	2	310	7	312	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	2.09e-17	2	322	10	335	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04LK0	7.18e-214	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=murG PE=3 SV=1
B2IN77	7.18e-214	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain CGSP14) OX=516950 GN=murG PE=3 SV=1
Q8DQM1	7.18e-214	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=murG PE=3 SV=1
C1CD52	2.06e-213	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=murG PE=3 SV=1
B8ZMZ7	2.92e-213	1	352	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) OX=561276 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001558_00336.